Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PKD2

Protein Details
Accession A0A433PKD2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-85QVRVYCLKLKKNSKNPCTIQKNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, plas 5, mito 4, E.R. 4, golg 4, vacu 2, mito_nucl 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRSIISILILLSLISLVCGCAEFLTYTIPKKDTQAEFCTEYKKKCREVSNGKAIELCEAWGKDQVRVYCLKLKKNSKNPCTIQKNWTQEVAKDLGVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.1
12 0.11
13 0.13
14 0.16
15 0.17
16 0.17
17 0.19
18 0.26
19 0.27
20 0.31
21 0.32
22 0.33
23 0.36
24 0.36
25 0.4
26 0.36
27 0.36
28 0.39
29 0.41
30 0.43
31 0.45
32 0.5
33 0.53
34 0.59
35 0.63
36 0.64
37 0.6
38 0.54
39 0.5
40 0.44
41 0.35
42 0.25
43 0.18
44 0.11
45 0.1
46 0.1
47 0.14
48 0.15
49 0.16
50 0.19
51 0.19
52 0.19
53 0.22
54 0.24
55 0.27
56 0.31
57 0.37
58 0.42
59 0.52
60 0.6
61 0.69
62 0.76
63 0.75
64 0.8
65 0.79
66 0.8
67 0.79
68 0.74
69 0.7
70 0.69
71 0.7
72 0.62
73 0.64
74 0.55
75 0.48
76 0.48
77 0.44
78 0.36