Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433PNV4

Protein Details
Accession A0A433PNV4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41KNIRGKGSKNFRVDKRRDKRRVIFTVTHydrophilic
NLS Segment(s)
PositionSequence
17-35IRGKGSKNFRVDKRRDKRR
Subcellular Location(s) mito 15, cyto 5, extr 5
Family & Domain DBs
Amino Acid Sequences MTYLFKFCISACKIKNIRGKGSKNFRVDKRRDKRRVIFTVTDSNSAIPELYNGGGGSGDGCLFVGDPIRPGNIIGDQPAAPLPTISRCITTSLTRCLRLPRSGRVAICVRLKTPSDWEGENNTYHEYKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.58
4 0.63
5 0.64
6 0.69
7 0.69
8 0.76
9 0.76
10 0.76
11 0.78
12 0.77
13 0.78
14 0.79
15 0.81
16 0.81
17 0.83
18 0.84
19 0.86
20 0.86
21 0.85
22 0.84
23 0.79
24 0.73
25 0.66
26 0.67
27 0.58
28 0.51
29 0.41
30 0.34
31 0.27
32 0.22
33 0.18
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.07
68 0.07
69 0.07
70 0.08
71 0.12
72 0.12
73 0.13
74 0.14
75 0.17
76 0.19
77 0.24
78 0.25
79 0.3
80 0.33
81 0.33
82 0.34
83 0.38
84 0.41
85 0.44
86 0.45
87 0.44
88 0.48
89 0.51
90 0.5
91 0.49
92 0.48
93 0.46
94 0.48
95 0.42
96 0.36
97 0.35
98 0.37
99 0.34
100 0.36
101 0.33
102 0.31
103 0.31
104 0.33
105 0.35
106 0.36
107 0.35
108 0.31
109 0.31