Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433PWP3

Protein Details
Accession A0A433PWP3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-96GRSRSHSRPSQRRDTRRSRSPSSNRRHRNESRSRTQSRHydrophilic
NLS Segment(s)
PositionSequence
46-107RHHHSSRSRGRGSGRSRSHSRPSQRRDTRRSRSPSSNRRHRNESRSRTQSRNPEDREDRRGR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIILTYEIPCRTALTDSLFLLLVHFPPPAHCNRSYSRSHSHSPRYRHHHSSRSRGRGSGRSRSHSRPSQRRDTRRSRSPSSNRRHRNESRSRTQSRNPEDREDRRGRSMTPRSRSPMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.21
4 0.22
5 0.21
6 0.19
7 0.18
8 0.16
9 0.11
10 0.1
11 0.1
12 0.09
13 0.1
14 0.14
15 0.18
16 0.22
17 0.23
18 0.27
19 0.31
20 0.37
21 0.4
22 0.42
23 0.45
24 0.45
25 0.5
26 0.53
27 0.59
28 0.6
29 0.62
30 0.66
31 0.66
32 0.68
33 0.7
34 0.7
35 0.69
36 0.68
37 0.72
38 0.72
39 0.72
40 0.67
41 0.61
42 0.57
43 0.57
44 0.55
45 0.54
46 0.49
47 0.47
48 0.5
49 0.53
50 0.56
51 0.55
52 0.59
53 0.59
54 0.62
55 0.67
56 0.72
57 0.76
58 0.77
59 0.81
60 0.8
61 0.8
62 0.8
63 0.76
64 0.77
65 0.78
66 0.8
67 0.8
68 0.82
69 0.81
70 0.8
71 0.83
72 0.81
73 0.81
74 0.82
75 0.8
76 0.8
77 0.8
78 0.8
79 0.77
80 0.77
81 0.76
82 0.74
83 0.75
84 0.7
85 0.7
86 0.73
87 0.73
88 0.74
89 0.72
90 0.68
91 0.65
92 0.63
93 0.56
94 0.58
95 0.62
96 0.62
97 0.61
98 0.64