Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433P7V9

Protein Details
Accession A0A433P7V9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-83ILALCRERRVRRERRERRSRVWILCRHydrophilic
NLS Segment(s)
PositionSequence
65-80RRVRRERRERRSRVWI
83-109RGRVRILSRSRVRILSRSRVRILSRSR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVRLIDVGGGGEKNKKKGSDIGRSGVSCRCVGIGMSSSGHEKVWICALCRQRRQCVWILALCRERRVRRERRERRSRVWILCRGRVRILSRSRVRILSRSRVRILSRSRVRILSRSRVRILSRSRVPILCCSRVRILNRSRVQILALCRSRVWIFALCRSRVWIFAFCRSRVWILCRSRVWSFALCRNRVWRLALCRNRVWRLALCRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.42
5 0.5
6 0.52
7 0.55
8 0.54
9 0.55
10 0.54
11 0.53
12 0.49
13 0.42
14 0.31
15 0.26
16 0.21
17 0.16
18 0.16
19 0.16
20 0.14
21 0.13
22 0.14
23 0.14
24 0.16
25 0.16
26 0.16
27 0.15
28 0.13
29 0.12
30 0.18
31 0.19
32 0.19
33 0.25
34 0.34
35 0.41
36 0.49
37 0.54
38 0.55
39 0.57
40 0.6
41 0.61
42 0.57
43 0.52
44 0.47
45 0.45
46 0.43
47 0.46
48 0.41
49 0.4
50 0.42
51 0.42
52 0.47
53 0.54
54 0.59
55 0.63
56 0.74
57 0.79
58 0.83
59 0.9
60 0.89
61 0.86
62 0.86
63 0.83
64 0.8
65 0.77
66 0.75
67 0.69
68 0.69
69 0.65
70 0.57
71 0.5
72 0.47
73 0.42
74 0.42
75 0.42
76 0.44
77 0.45
78 0.47
79 0.47
80 0.47
81 0.45
82 0.44
83 0.43
84 0.44
85 0.46
86 0.46
87 0.46
88 0.46
89 0.46
90 0.46
91 0.46
92 0.46
93 0.46
94 0.46
95 0.46
96 0.46
97 0.46
98 0.46
99 0.46
100 0.46
101 0.46
102 0.46
103 0.46
104 0.46
105 0.46
106 0.46
107 0.46
108 0.44
109 0.43
110 0.42
111 0.43
112 0.41
113 0.41
114 0.42
115 0.43
116 0.41
117 0.37
118 0.36
119 0.38
120 0.41
121 0.43
122 0.43
123 0.43
124 0.47
125 0.5
126 0.5
127 0.47
128 0.42
129 0.4
130 0.35
131 0.32
132 0.31
133 0.3
134 0.27
135 0.26
136 0.28
137 0.27
138 0.25
139 0.24
140 0.21
141 0.21
142 0.29
143 0.35
144 0.34
145 0.34
146 0.37
147 0.34
148 0.31
149 0.32
150 0.31
151 0.28
152 0.36
153 0.41
154 0.38
155 0.4
156 0.39
157 0.39
158 0.36
159 0.37
160 0.37
161 0.38
162 0.45
163 0.45
164 0.48
165 0.46
166 0.45
167 0.44
168 0.42
169 0.41
170 0.42
171 0.48
172 0.45
173 0.48
174 0.52
175 0.53
176 0.5
177 0.5
178 0.48
179 0.49
180 0.58
181 0.62
182 0.62
183 0.65
184 0.7
185 0.7
186 0.66
187 0.61
188 0.58