Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PX72

Protein Details
Accession A0A433PX72    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-68APSRSPAPARRHLRHRRRKPQAQRYVARGTVHydrophilic
NLS Segment(s)
PositionSequence
38-58APSRSPAPARRHLRHRRRKPQ
Subcellular Location(s) mito 12, extr 5, nucl 4, cyto 3, pero 2
Family & Domain DBs
Amino Acid Sequences MRHLSRKAWIRDVDHLQTPVTLVASILASAPAPAPAPAPSRSPAPARRHLRHRRRKPQAQRYVARGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.39
4 0.33
5 0.29
6 0.22
7 0.15
8 0.11
9 0.07
10 0.06
11 0.06
12 0.06
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.07
23 0.1
24 0.11
25 0.13
26 0.14
27 0.16
28 0.19
29 0.24
30 0.31
31 0.35
32 0.43
33 0.5
34 0.56
35 0.65
36 0.74
37 0.79
38 0.82
39 0.87
40 0.88
41 0.9
42 0.94
43 0.95
44 0.95
45 0.95
46 0.94
47 0.89
48 0.85