Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433P782

Protein Details
Accession A0A433P782   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
117-143MLFCPPTRYPKRPSRARKVGKPSVSTHHydrophilic
NLS Segment(s)
PositionSequence
127-136KRPSRARKVG
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008603  DCTN4  
Gene Ontology GO:0005869  C:dynactin complex  
GO:0005815  C:microtubule organizing center  
GO:0030017  C:sarcomere  
Pfam View protein in Pfam  
PF05502  Dynactin_p62  
Amino Acid Sequences MRLNPFVHYYCPCPDIYYESEATSESAGSVPLAPIADATHTLDISSPRTEFSLHSLSRLYFCEDCHQIRCPACVQDEIISYYCPNCLFEVRLLSCRTTNRYIPGYVVLYERGFFFIMLFCPPTRYPKRPSRARKVGKPSVSTHPVPTKQLNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.28
5 0.26
6 0.24
7 0.24
8 0.23
9 0.22
10 0.16
11 0.13
12 0.08
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.09
26 0.09
27 0.09
28 0.09
29 0.1
30 0.12
31 0.13
32 0.14
33 0.12
34 0.12
35 0.13
36 0.14
37 0.13
38 0.16
39 0.21
40 0.2
41 0.21
42 0.21
43 0.21
44 0.22
45 0.22
46 0.21
47 0.14
48 0.15
49 0.18
50 0.21
51 0.22
52 0.23
53 0.24
54 0.25
55 0.25
56 0.26
57 0.22
58 0.21
59 0.2
60 0.18
61 0.17
62 0.14
63 0.14
64 0.15
65 0.13
66 0.12
67 0.11
68 0.1
69 0.1
70 0.09
71 0.09
72 0.07
73 0.08
74 0.09
75 0.1
76 0.15
77 0.16
78 0.2
79 0.2
80 0.2
81 0.22
82 0.23
83 0.27
84 0.26
85 0.27
86 0.28
87 0.29
88 0.29
89 0.27
90 0.27
91 0.24
92 0.2
93 0.19
94 0.17
95 0.14
96 0.14
97 0.13
98 0.12
99 0.11
100 0.1
101 0.09
102 0.08
103 0.09
104 0.1
105 0.12
106 0.11
107 0.15
108 0.16
109 0.25
110 0.33
111 0.38
112 0.45
113 0.53
114 0.63
115 0.69
116 0.79
117 0.8
118 0.83
119 0.87
120 0.89
121 0.89
122 0.89
123 0.86
124 0.8
125 0.74
126 0.72
127 0.69
128 0.61
129 0.59
130 0.58
131 0.55
132 0.55