Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433PWD3

Protein Details
Accession A0A433PWD3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27DVMTLRKYKRVHKIRFKGKQREDLVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MDVMTLRKYKRVHKIRFKGKQREDLVSAVTRHFANQNIKEIDAVTTFLYSVHNKGEFDSFSSLLDIGAIFCTGVQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.9
4 0.91
5 0.92
6 0.88
7 0.87
8 0.8
9 0.74
10 0.66
11 0.57
12 0.49
13 0.42
14 0.35
15 0.25
16 0.23
17 0.18
18 0.16
19 0.16
20 0.18
21 0.21
22 0.22
23 0.28
24 0.27
25 0.27
26 0.27
27 0.25
28 0.21
29 0.15
30 0.13
31 0.08
32 0.07
33 0.07
34 0.07
35 0.09
36 0.09
37 0.1
38 0.12
39 0.14
40 0.14
41 0.15
42 0.18
43 0.16
44 0.18
45 0.21
46 0.18
47 0.17
48 0.17
49 0.16
50 0.13
51 0.13
52 0.09
53 0.06
54 0.07
55 0.06
56 0.05