Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PME6

Protein Details
Accession A0A433PME6   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-97KVKSLFSKKKKQKVVEEEEKEBasic
NLS Segment(s)
PositionSequence
83-87SKKKK
Subcellular Location(s) cyto 14, cyto_nucl 12.333, nucl 8.5, mito_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MAEEQEIKSESVVVSETPVVAVTTEITETTEANLAVVIVETENTTTEVSAEGIAETEKKSKSAHAPGPRGLGLWIEKVKSLFSKKKKQKVVEEEEKEKINEEEKLVISDTVPQIEASVVETSVVEDAEVNSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.09
6 0.08
7 0.07
8 0.07
9 0.06
10 0.06
11 0.07
12 0.07
13 0.07
14 0.08
15 0.08
16 0.08
17 0.1
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.06
24 0.05
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.04
39 0.05
40 0.05
41 0.05
42 0.06
43 0.09
44 0.09
45 0.1
46 0.11
47 0.13
48 0.19
49 0.25
50 0.32
51 0.36
52 0.39
53 0.4
54 0.42
55 0.39
56 0.34
57 0.27
58 0.21
59 0.14
60 0.14
61 0.13
62 0.11
63 0.12
64 0.12
65 0.13
66 0.16
67 0.22
68 0.27
69 0.35
70 0.46
71 0.54
72 0.63
73 0.71
74 0.75
75 0.78
76 0.79
77 0.81
78 0.81
79 0.78
80 0.74
81 0.68
82 0.62
83 0.52
84 0.44
85 0.35
86 0.27
87 0.22
88 0.19
89 0.2
90 0.18
91 0.2
92 0.19
93 0.18
94 0.15
95 0.18
96 0.18
97 0.15
98 0.15
99 0.13
100 0.13
101 0.13
102 0.13
103 0.1
104 0.1
105 0.08
106 0.08
107 0.08
108 0.09
109 0.09
110 0.09
111 0.06
112 0.06