Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1V2G3

Protein Details
Accession K1V2G3   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKVSTKDDKKVAKRGKKDPNKPKRALSAYHydrophilic
NLS Segment(s)
PositionSequence
10-25KKVAKRGKKDPNKPKR
97-98KK
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKVSTKDDKKVAKRGKKDPNKPKRALSAYMFFVQDWRERIKSENPDADFGSVGRLLGAKWQEMSASEKKPYEDKAQADKDRAAKEKAEYDAANGKKKRSAKVQEDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.85
5 0.89
6 0.89
7 0.9
8 0.9
9 0.86
10 0.82
11 0.81
12 0.75
13 0.7
14 0.63
15 0.57
16 0.5
17 0.47
18 0.41
19 0.31
20 0.27
21 0.23
22 0.22
23 0.19
24 0.2
25 0.19
26 0.19
27 0.23
28 0.29
29 0.34
30 0.36
31 0.4
32 0.37
33 0.37
34 0.37
35 0.34
36 0.27
37 0.2
38 0.15
39 0.09
40 0.08
41 0.06
42 0.05
43 0.05
44 0.08
45 0.09
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.15
52 0.17
53 0.19
54 0.22
55 0.22
56 0.24
57 0.26
58 0.29
59 0.3
60 0.31
61 0.33
62 0.39
63 0.47
64 0.49
65 0.5
66 0.5
67 0.49
68 0.49
69 0.48
70 0.42
71 0.36
72 0.36
73 0.38
74 0.36
75 0.35
76 0.29
77 0.29
78 0.35
79 0.37
80 0.43
81 0.4
82 0.4
83 0.43
84 0.48
85 0.52
86 0.54
87 0.6
88 0.6