Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PI11

Protein Details
Accession A0A433PI11    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-33VSVIRAKRKQINKYNPAPLPHydrophilic
NLS Segment(s)
PositionSequence
84-93KGAAERPRPR
Subcellular Location(s) mito 13, extr 5, nucl 3.5, cyto_nucl 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019727  ATP_synth_F0_fsu_mt_fun  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF10791  F1F0-ATPsyn_F  
Amino Acid Sequences SDFAVTSQQILAGVSVIRAKRKQINKYNPAPLPTPHSDMNTIIRRAYSTKSLIPPNLATTKGVSAPKDVARLRNMVDLYKRLPKGAAERPRPRGLIGRYKARYFDGENASPAPLIHAIIGVIGISYAIDYHFHLKHHKSVEHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.12
3 0.13
4 0.19
5 0.21
6 0.26
7 0.34
8 0.43
9 0.53
10 0.59
11 0.68
12 0.72
13 0.78
14 0.82
15 0.76
16 0.71
17 0.63
18 0.54
19 0.5
20 0.45
21 0.41
22 0.34
23 0.32
24 0.31
25 0.3
26 0.36
27 0.34
28 0.31
29 0.27
30 0.25
31 0.24
32 0.25
33 0.25
34 0.22
35 0.19
36 0.23
37 0.27
38 0.3
39 0.3
40 0.3
41 0.28
42 0.28
43 0.27
44 0.23
45 0.19
46 0.16
47 0.17
48 0.18
49 0.19
50 0.16
51 0.15
52 0.17
53 0.18
54 0.23
55 0.23
56 0.22
57 0.22
58 0.23
59 0.22
60 0.23
61 0.22
62 0.18
63 0.19
64 0.18
65 0.19
66 0.25
67 0.24
68 0.2
69 0.2
70 0.21
71 0.26
72 0.33
73 0.4
74 0.43
75 0.5
76 0.56
77 0.59
78 0.58
79 0.52
80 0.5
81 0.47
82 0.48
83 0.45
84 0.49
85 0.49
86 0.49
87 0.49
88 0.44
89 0.41
90 0.34
91 0.37
92 0.33
93 0.32
94 0.32
95 0.31
96 0.3
97 0.26
98 0.23
99 0.17
100 0.11
101 0.1
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.05
108 0.04
109 0.03
110 0.03
111 0.02
112 0.03
113 0.03
114 0.03
115 0.05
116 0.07
117 0.12
118 0.14
119 0.17
120 0.25
121 0.29
122 0.36
123 0.42