Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PUA7

Protein Details
Accession A0A433PUA7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-84DIVKRWKKTTGRKVQKKFISLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MGVSVSSIIHQFRWNRRSFTAKESKLRIFVDVSDVASYVVRAVVDRRVENKKLWLDNNPSTQLDIVKRWKKTTGRKVQKKFISLEEAEMECKKAKGFFLSFCGRLLFWFSTRVWLYNPYSLRALPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.52
4 0.59
5 0.57
6 0.59
7 0.6
8 0.59
9 0.61
10 0.62
11 0.61
12 0.59
13 0.56
14 0.48
15 0.38
16 0.32
17 0.29
18 0.24
19 0.22
20 0.16
21 0.15
22 0.14
23 0.12
24 0.11
25 0.07
26 0.06
27 0.05
28 0.05
29 0.06
30 0.11
31 0.13
32 0.15
33 0.2
34 0.26
35 0.28
36 0.29
37 0.34
38 0.35
39 0.36
40 0.37
41 0.38
42 0.39
43 0.41
44 0.44
45 0.4
46 0.35
47 0.31
48 0.29
49 0.25
50 0.2
51 0.19
52 0.24
53 0.27
54 0.29
55 0.3
56 0.36
57 0.42
58 0.51
59 0.57
60 0.6
61 0.66
62 0.74
63 0.8
64 0.83
65 0.8
66 0.74
67 0.66
68 0.58
69 0.54
70 0.44
71 0.39
72 0.33
73 0.28
74 0.26
75 0.23
76 0.21
77 0.15
78 0.16
79 0.14
80 0.13
81 0.14
82 0.18
83 0.2
84 0.21
85 0.26
86 0.31
87 0.31
88 0.3
89 0.3
90 0.24
91 0.22
92 0.25
93 0.21
94 0.17
95 0.2
96 0.19
97 0.25
98 0.27
99 0.28
100 0.25
101 0.28
102 0.31
103 0.35
104 0.37
105 0.33
106 0.34