Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VRL2

Protein Details
Accession K1VRL2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-108PLDLRYKKTRAIRRRLTEKEKNAKTVHydrophilic
NLS Segment(s)
PositionSequence
88-121YKKTRAIRRRLTEKEKNAKTVKAQKKAIHFPQRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSLKIRASELQSKNKEALMEQLTELRTELTSLRVQKAVGGSASKLTKINTVRKSIARVLTVVNQKQRQNLREFYKKSKYIPLDLRYKKTRAIRRRLTEKEKNAKTVKAQKKAIHFPQRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.5
4 0.44
5 0.35
6 0.35
7 0.27
8 0.24
9 0.22
10 0.24
11 0.23
12 0.22
13 0.22
14 0.15
15 0.12
16 0.11
17 0.11
18 0.11
19 0.15
20 0.18
21 0.2
22 0.2
23 0.2
24 0.21
25 0.21
26 0.19
27 0.15
28 0.13
29 0.12
30 0.15
31 0.15
32 0.14
33 0.14
34 0.14
35 0.19
36 0.23
37 0.31
38 0.32
39 0.36
40 0.38
41 0.39
42 0.43
43 0.41
44 0.38
45 0.3
46 0.26
47 0.23
48 0.26
49 0.29
50 0.28
51 0.3
52 0.31
53 0.32
54 0.37
55 0.41
56 0.4
57 0.4
58 0.44
59 0.45
60 0.5
61 0.53
62 0.55
63 0.58
64 0.57
65 0.54
66 0.56
67 0.52
68 0.5
69 0.54
70 0.52
71 0.54
72 0.56
73 0.61
74 0.57
75 0.56
76 0.55
77 0.56
78 0.6
79 0.6
80 0.65
81 0.68
82 0.73
83 0.81
84 0.84
85 0.85
86 0.85
87 0.85
88 0.85
89 0.8
90 0.79
91 0.73
92 0.67
93 0.67
94 0.68
95 0.67
96 0.66
97 0.69
98 0.65
99 0.71
100 0.77
101 0.78
102 0.78
103 0.76
104 0.72
105 0.75
106 0.8