Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LME4

Protein Details
Accession E2LME4   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-141AGGIWRFKQQEKPKRTKKRFBasic
NLS Segment(s)
PositionSequence
132-141EKPKRTKKRF
Subcellular Location(s) nucl 14, mito 7, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005365  Npr3  
Gene Ontology GO:0005774  C:vacuolar membrane  
GO:0051321  P:meiotic cell cycle  
GO:0032007  P:negative regulation of TOR signaling  
KEGG mpr:MPER_07938  -  
Pfam View protein in Pfam  
PF03666  NPR3  
Amino Acid Sequences MSETLLAILFVTSSAKGSNLVFRWPPCPEVPLKLSRAPPEGQGNILDPSYKRRVSSSTNEPSPSTNDSTDSLNCRKEYEEVFGYSSEFLAGILCPHASMCHQKFELVVDDLAFIGHPVCAEAGGIWRFKQQEKPKRTKKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.1
5 0.17
6 0.17
7 0.22
8 0.25
9 0.26
10 0.31
11 0.31
12 0.33
13 0.28
14 0.3
15 0.28
16 0.3
17 0.32
18 0.34
19 0.36
20 0.38
21 0.4
22 0.4
23 0.42
24 0.37
25 0.36
26 0.36
27 0.33
28 0.29
29 0.26
30 0.24
31 0.21
32 0.2
33 0.17
34 0.12
35 0.17
36 0.22
37 0.22
38 0.21
39 0.21
40 0.25
41 0.3
42 0.36
43 0.4
44 0.41
45 0.43
46 0.44
47 0.43
48 0.4
49 0.37
50 0.33
51 0.26
52 0.19
53 0.18
54 0.17
55 0.18
56 0.19
57 0.2
58 0.2
59 0.2
60 0.2
61 0.19
62 0.19
63 0.2
64 0.2
65 0.2
66 0.19
67 0.17
68 0.18
69 0.17
70 0.17
71 0.15
72 0.13
73 0.08
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.07
85 0.16
86 0.18
87 0.23
88 0.23
89 0.24
90 0.24
91 0.26
92 0.27
93 0.2
94 0.19
95 0.13
96 0.13
97 0.13
98 0.12
99 0.1
100 0.06
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.11
110 0.13
111 0.14
112 0.15
113 0.19
114 0.22
115 0.26
116 0.36
117 0.41
118 0.49
119 0.58
120 0.69
121 0.75