Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433P8U3

Protein Details
Accession A0A433P8U3    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-40KNPTDFPTSPRPRRNGKKDPPKLTRDVHydrophilic
55-88GHVVKSNGKNKRRTRSPPKYRRGRNGNYRPQIGRBasic
NLS Segment(s)
PositionSequence
25-31PRRNGKK
62-83GKNKRRTRSPPKYRRGRNGNYR
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MAQEFSHAKNKYVKNPTDFPTSPRPRRNGKKDPPKLTRDVVQQNSHDILERNCQGHVVKSNGKNKRRTRSPPKYRRGRNGNYRPQIGRFGTRKVPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.63
4 0.63
5 0.58
6 0.53
7 0.54
8 0.58
9 0.6
10 0.62
11 0.64
12 0.65
13 0.75
14 0.8
15 0.8
16 0.81
17 0.83
18 0.86
19 0.89
20 0.87
21 0.81
22 0.76
23 0.67
24 0.62
25 0.58
26 0.56
27 0.52
28 0.48
29 0.43
30 0.41
31 0.39
32 0.34
33 0.27
34 0.2
35 0.15
36 0.16
37 0.17
38 0.15
39 0.14
40 0.15
41 0.15
42 0.17
43 0.2
44 0.2
45 0.25
46 0.31
47 0.4
48 0.48
49 0.55
50 0.62
51 0.66
52 0.71
53 0.75
54 0.78
55 0.81
56 0.83
57 0.88
58 0.89
59 0.91
60 0.92
61 0.91
62 0.91
63 0.9
64 0.89
65 0.89
66 0.89
67 0.9
68 0.86
69 0.84
70 0.76
71 0.69
72 0.67
73 0.59
74 0.58
75 0.51
76 0.49