Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433P5H4

Protein Details
Accession A0A433P5H4   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-37LDFCKIFKRTARRKPPINILLKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000244  Ribosomal_L9  
IPR020069  Ribosomal_L9_C  
IPR036791  Ribosomal_L9_C_sf  
IPR020070  Ribosomal_L9_N  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF03948  Ribosomal_L9_C  
PF01281  Ribosomal_L9_N  
Amino Acid Sequences MSLFSSRIAPLSRSLDFCKIFKRTARRKPPINILLKETVEGVGNKAGYMRNVLLPRNKASYIQVYTRERQALEAGQHQREQADQLLVQLRALQEPLEFQRAVVPGTTGTFGSVTLEDVIDKLRKEFGISVDKHQIEFNTEGGKLKALGEYELVVKFPNLKKEEKLGIIVKATQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.38
4 0.39
5 0.41
6 0.4
7 0.42
8 0.45
9 0.52
10 0.55
11 0.64
12 0.73
13 0.75
14 0.79
15 0.82
16 0.85
17 0.84
18 0.82
19 0.74
20 0.68
21 0.64
22 0.56
23 0.49
24 0.38
25 0.29
26 0.22
27 0.2
28 0.16
29 0.12
30 0.12
31 0.11
32 0.12
33 0.12
34 0.11
35 0.13
36 0.13
37 0.16
38 0.18
39 0.22
40 0.26
41 0.28
42 0.31
43 0.32
44 0.31
45 0.27
46 0.28
47 0.31
48 0.28
49 0.28
50 0.33
51 0.33
52 0.35
53 0.37
54 0.36
55 0.29
56 0.27
57 0.25
58 0.2
59 0.18
60 0.24
61 0.24
62 0.24
63 0.25
64 0.24
65 0.22
66 0.2
67 0.2
68 0.13
69 0.1
70 0.08
71 0.09
72 0.12
73 0.12
74 0.11
75 0.11
76 0.1
77 0.09
78 0.1
79 0.08
80 0.05
81 0.07
82 0.09
83 0.11
84 0.11
85 0.1
86 0.14
87 0.14
88 0.14
89 0.13
90 0.11
91 0.08
92 0.09
93 0.1
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.09
106 0.1
107 0.1
108 0.1
109 0.12
110 0.12
111 0.14
112 0.15
113 0.18
114 0.25
115 0.27
116 0.31
117 0.37
118 0.38
119 0.37
120 0.36
121 0.31
122 0.27
123 0.26
124 0.23
125 0.17
126 0.18
127 0.18
128 0.18
129 0.18
130 0.14
131 0.14
132 0.14
133 0.12
134 0.12
135 0.12
136 0.12
137 0.14
138 0.14
139 0.13
140 0.12
141 0.11
142 0.18
143 0.21
144 0.29
145 0.3
146 0.34
147 0.37
148 0.44
149 0.5
150 0.45
151 0.48
152 0.43
153 0.42