Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433PV67

Protein Details
Accession A0A433PV67    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
211-230ISDHNKRKPKLRLHWISFLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026015  ATP_synth_OSCP/delta_N_sf  
IPR020781  ATPase_OSCP/d_CS  
IPR000711  ATPase_OSCP/dsu  
Gene Ontology GO:0016020  C:membrane  
GO:0046933  F:proton-transporting ATP synthase activity, rotational mechanism  
Pfam View protein in Pfam  
PF00213  OSCP  
PROSITE View protein in PROSITE  
PS00389  ATPASE_DELTA  
Amino Acid Sequences MASRIAPKLLARAYATATQKSVQVPIVLYGIDGRYATALYTAAAKKQALEAVENDLKQVATVLNKEKGLQDILLNPTLNREAKKKGVKEIFKAGKYSDLTQNLFQTLAENGRLNAALKIIDSYSQLMTAYRGEMPVIITSAKELETSNLNKLKESLNKSPLAKSHKLLFSNKVNPSILGGIVIEFGDKTIDLSVSSGLAKLNKLIPSKFVISDHNKRKPKLRLHWISFLTSTIDYAIQTMECKTSPCFSLALFNLTGWRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.32
4 0.31
5 0.28
6 0.3
7 0.29
8 0.28
9 0.23
10 0.21
11 0.19
12 0.19
13 0.19
14 0.16
15 0.14
16 0.13
17 0.12
18 0.11
19 0.1
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.06
27 0.12
28 0.13
29 0.14
30 0.17
31 0.17
32 0.17
33 0.19
34 0.21
35 0.17
36 0.18
37 0.17
38 0.22
39 0.25
40 0.24
41 0.22
42 0.2
43 0.19
44 0.17
45 0.16
46 0.1
47 0.1
48 0.14
49 0.18
50 0.21
51 0.22
52 0.23
53 0.23
54 0.23
55 0.22
56 0.19
57 0.16
58 0.17
59 0.19
60 0.22
61 0.21
62 0.18
63 0.19
64 0.22
65 0.23
66 0.21
67 0.21
68 0.23
69 0.31
70 0.39
71 0.4
72 0.45
73 0.52
74 0.54
75 0.55
76 0.6
77 0.59
78 0.53
79 0.52
80 0.43
81 0.4
82 0.37
83 0.36
84 0.32
85 0.29
86 0.29
87 0.3
88 0.3
89 0.25
90 0.23
91 0.19
92 0.14
93 0.11
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.1
100 0.09
101 0.09
102 0.08
103 0.06
104 0.06
105 0.07
106 0.06
107 0.06
108 0.06
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.07
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.1
133 0.12
134 0.18
135 0.21
136 0.21
137 0.21
138 0.22
139 0.26
140 0.28
141 0.33
142 0.35
143 0.35
144 0.39
145 0.41
146 0.42
147 0.43
148 0.44
149 0.4
150 0.35
151 0.37
152 0.38
153 0.41
154 0.41
155 0.42
156 0.42
157 0.48
158 0.48
159 0.45
160 0.4
161 0.36
162 0.35
163 0.3
164 0.21
165 0.14
166 0.11
167 0.07
168 0.07
169 0.07
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.06
180 0.06
181 0.07
182 0.07
183 0.07
184 0.08
185 0.09
186 0.09
187 0.11
188 0.15
189 0.19
190 0.22
191 0.22
192 0.24
193 0.27
194 0.3
195 0.29
196 0.27
197 0.3
198 0.35
199 0.45
200 0.53
201 0.58
202 0.63
203 0.64
204 0.71
205 0.73
206 0.75
207 0.75
208 0.76
209 0.77
210 0.77
211 0.83
212 0.76
213 0.7
214 0.6
215 0.5
216 0.42
217 0.32
218 0.25
219 0.17
220 0.15
221 0.12
222 0.11
223 0.11
224 0.09
225 0.1
226 0.11
227 0.12
228 0.12
229 0.14
230 0.16
231 0.18
232 0.19
233 0.2
234 0.19
235 0.18
236 0.25
237 0.25
238 0.27
239 0.24
240 0.23
241 0.28