Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PCA7

Protein Details
Accession A0A433PCA7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-66ENLILRLDGKKKKRKKERKKEQIRNSQRPDKEBasic
NLS Segment(s)
PositionSequence
43-57GKKKKRKKERKKEQI
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MACGASFDIAANNIHVGSYKLGLLLGSPVYVYGQENLILRLDGKKKKRKKERKKEQIRNSQRPDKETPNHIDLSSPVDRHTTTTSSMTEDVKTPAPEHAIGKLFVNIIEARNLNVSQPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.1
6 0.09
7 0.09
8 0.09
9 0.09
10 0.08
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.06
20 0.07
21 0.09
22 0.09
23 0.1
24 0.1
25 0.09
26 0.09
27 0.14
28 0.21
29 0.27
30 0.35
31 0.45
32 0.53
33 0.64
34 0.75
35 0.8
36 0.85
37 0.89
38 0.91
39 0.93
40 0.96
41 0.96
42 0.95
43 0.95
44 0.94
45 0.92
46 0.88
47 0.85
48 0.76
49 0.7
50 0.64
51 0.61
52 0.55
53 0.5
54 0.48
55 0.43
56 0.42
57 0.37
58 0.32
59 0.25
60 0.27
61 0.23
62 0.19
63 0.16
64 0.16
65 0.17
66 0.19
67 0.21
68 0.16
69 0.16
70 0.19
71 0.19
72 0.2
73 0.21
74 0.2
75 0.18
76 0.18
77 0.18
78 0.19
79 0.2
80 0.18
81 0.18
82 0.19
83 0.2
84 0.2
85 0.23
86 0.22
87 0.22
88 0.22
89 0.22
90 0.19
91 0.17
92 0.18
93 0.15
94 0.13
95 0.17
96 0.16
97 0.16
98 0.19
99 0.19