Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PPS8

Protein Details
Accession A0A433PPS8   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
4-33APLHSQLEKKLKQKKQKDKGQRNPQQPLAPHydrophilic
NLS Segment(s)
PositionSequence
13-21KLKQKKQKD
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MSDAPLHSQLEKKLKQKKQKDKGQRNPQQPLAPTPAAIPLLREFLDVPGVPGDPERKLTIMTYNILAQSLIRRELFPHAGNALKRKPRQTLIMDEFNLYKPEIACLQEVDHLEDEYGNAFKMAGCVCEGEIWRVSSMLVRLTFIKLFHDHSWDSQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.79
4 0.84
5 0.84
6 0.88
7 0.91
8 0.92
9 0.94
10 0.94
11 0.93
12 0.91
13 0.88
14 0.84
15 0.79
16 0.69
17 0.64
18 0.59
19 0.5
20 0.41
21 0.33
22 0.3
23 0.25
24 0.23
25 0.19
26 0.13
27 0.15
28 0.15
29 0.15
30 0.13
31 0.12
32 0.15
33 0.13
34 0.12
35 0.11
36 0.1
37 0.1
38 0.11
39 0.12
40 0.1
41 0.12
42 0.12
43 0.12
44 0.12
45 0.13
46 0.15
47 0.15
48 0.15
49 0.14
50 0.14
51 0.14
52 0.13
53 0.12
54 0.09
55 0.09
56 0.1
57 0.11
58 0.1
59 0.1
60 0.11
61 0.15
62 0.18
63 0.16
64 0.15
65 0.14
66 0.17
67 0.18
68 0.21
69 0.24
70 0.28
71 0.31
72 0.34
73 0.37
74 0.37
75 0.43
76 0.42
77 0.45
78 0.44
79 0.46
80 0.43
81 0.39
82 0.37
83 0.32
84 0.29
85 0.2
86 0.15
87 0.1
88 0.11
89 0.12
90 0.12
91 0.12
92 0.11
93 0.12
94 0.15
95 0.15
96 0.16
97 0.15
98 0.14
99 0.13
100 0.12
101 0.12
102 0.09
103 0.09
104 0.06
105 0.06
106 0.06
107 0.06
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.09
114 0.12
115 0.13
116 0.14
117 0.16
118 0.16
119 0.16
120 0.15
121 0.15
122 0.15
123 0.15
124 0.17
125 0.15
126 0.16
127 0.17
128 0.2
129 0.22
130 0.2
131 0.23
132 0.21
133 0.26
134 0.27
135 0.31
136 0.3