Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PMR2

Protein Details
Accession A0A433PMR2    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-49PAVKRVIVKKRRATFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
8-52RVIVKKRRATFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGQAP
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSPAVKRVIVKKRRATFKRHQSDRYKSVKESWRKPKGIDNRVRRRFKGQAPMPKIGYGSARATRHMLPNGFRKFVVSNVKELELLLMHNRSYAAEIAHNVSSLNRIAIVQRAAQLNVKITNATARVRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.8
4 0.8
5 0.82
6 0.83
7 0.82
8 0.82
9 0.81
10 0.85
11 0.85
12 0.83
13 0.77
14 0.68
15 0.68
16 0.68
17 0.68
18 0.69
19 0.7
20 0.7
21 0.68
22 0.68
23 0.69
24 0.7
25 0.71
26 0.71
27 0.71
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.7
34 0.67
35 0.67
36 0.63
37 0.63
38 0.63
39 0.65
40 0.58
41 0.51
42 0.45
43 0.35
44 0.29
45 0.21
46 0.18
47 0.2
48 0.19
49 0.19
50 0.21
51 0.22
52 0.24
53 0.25
54 0.23
55 0.21
56 0.3
57 0.31
58 0.3
59 0.28
60 0.27
61 0.24
62 0.28
63 0.34
64 0.26
65 0.26
66 0.26
67 0.27
68 0.26
69 0.25
70 0.2
71 0.11
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.1
78 0.09
79 0.1
80 0.1
81 0.09
82 0.09
83 0.11
84 0.13
85 0.13
86 0.13
87 0.12
88 0.11
89 0.12
90 0.11
91 0.1
92 0.08
93 0.08
94 0.09
95 0.13
96 0.15
97 0.14
98 0.17
99 0.19
100 0.2
101 0.23
102 0.24
103 0.24
104 0.25
105 0.24
106 0.21
107 0.19
108 0.23
109 0.23
110 0.25
111 0.25