Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A433P9E7

Protein Details
Accession A0A433P9E7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-77SLNVQISKERKKERKKRRNEICDIHTKPHydrophilic
NLS Segment(s)
PositionSequence
57-67KERKKERKKRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDEITTRGWMPSEATLNSESDHGQFDLPVVSLVLKYLCSESGENRIDTWSLNVQISKERKKERKKRRNEICDIHTKPKAQTAEMLHITEITSCICTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.2
5 0.19
6 0.15
7 0.12
8 0.14
9 0.12
10 0.11
11 0.1
12 0.1
13 0.1
14 0.09
15 0.08
16 0.06
17 0.06
18 0.05
19 0.06
20 0.06
21 0.05
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.1
28 0.18
29 0.19
30 0.19
31 0.18
32 0.18
33 0.17
34 0.16
35 0.16
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.17
42 0.23
43 0.28
44 0.33
45 0.41
46 0.5
47 0.61
48 0.71
49 0.76
50 0.81
51 0.85
52 0.89
53 0.91
54 0.92
55 0.9
56 0.88
57 0.83
58 0.83
59 0.78
60 0.75
61 0.68
62 0.6
63 0.52
64 0.51
65 0.46
66 0.37
67 0.37
68 0.35
69 0.39
70 0.39
71 0.38
72 0.31
73 0.29
74 0.28
75 0.23
76 0.19
77 0.11