Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PLW9

Protein Details
Accession A0A433PLW9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
37-64LAGHVKRQRQLPKRYRRRPQGVQRQLRDHydrophilic
NLS Segment(s)
PositionSequence
43-54RQRQLPKRYRRR
Subcellular Location(s) cyto 15.5, cyto_nucl 11.5, nucl 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTGPVDCIGLDRSRTIPQHAKCAQQPTQKVCVASKSLAGHVKRQRQLPKRYRRRPQGVQRQLRDMSRAHGACQETAMWTSVPFVSEGPCVYLLFFVVIHKYNLTNPLLQLLTIQRMSQVLGRVPHFQLDLSDLPPLVVRTQDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.38
4 0.38
5 0.47
6 0.48
7 0.52
8 0.51
9 0.57
10 0.57
11 0.56
12 0.61
13 0.57
14 0.6
15 0.57
16 0.54
17 0.47
18 0.44
19 0.39
20 0.33
21 0.31
22 0.25
23 0.27
24 0.32
25 0.31
26 0.36
27 0.4
28 0.48
29 0.48
30 0.54
31 0.6
32 0.63
33 0.72
34 0.74
35 0.78
36 0.8
37 0.86
38 0.88
39 0.89
40 0.89
41 0.88
42 0.89
43 0.89
44 0.88
45 0.87
46 0.79
47 0.75
48 0.68
49 0.58
50 0.5
51 0.39
52 0.31
53 0.28
54 0.26
55 0.2
56 0.22
57 0.22
58 0.19
59 0.19
60 0.17
61 0.11
62 0.11
63 0.11
64 0.07
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.06
71 0.07
72 0.07
73 0.08
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.07
80 0.06
81 0.07
82 0.06
83 0.07
84 0.08
85 0.09
86 0.1
87 0.1
88 0.11
89 0.16
90 0.17
91 0.16
92 0.15
93 0.18
94 0.17
95 0.16
96 0.17
97 0.14
98 0.17
99 0.16
100 0.16
101 0.13
102 0.14
103 0.15
104 0.16
105 0.17
106 0.16
107 0.2
108 0.23
109 0.26
110 0.27
111 0.28
112 0.26
113 0.23
114 0.2
115 0.21
116 0.21
117 0.17
118 0.18
119 0.16
120 0.16
121 0.17
122 0.17
123 0.13
124 0.12