Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VVK5

Protein Details
Accession K1VVK5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-54SGNNKPFSLKKTRRNWKPNVHIMNMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9.5, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Amino Acid Sequences MSAPLRNFGARKLLSKQAHPAILPLPAQQSGNNKPFSLKKTRRNWKPNVHIMNMPVNILGGAPTIAQNLANLNESKFVRGPHLKRVKLAARDKKTVDKAGGVEGLLLSLPASKLTPYGQLLRTELFRELHSIKAQIEANPEEKVAPKLIEGAVSAEAADAAEQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.52
4 0.49
5 0.49
6 0.45
7 0.42
8 0.34
9 0.34
10 0.31
11 0.24
12 0.21
13 0.19
14 0.19
15 0.2
16 0.26
17 0.3
18 0.36
19 0.36
20 0.33
21 0.35
22 0.4
23 0.43
24 0.47
25 0.48
26 0.52
27 0.61
28 0.72
29 0.79
30 0.83
31 0.87
32 0.86
33 0.87
34 0.87
35 0.82
36 0.75
37 0.66
38 0.59
39 0.56
40 0.46
41 0.36
42 0.26
43 0.19
44 0.16
45 0.13
46 0.1
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.08
58 0.08
59 0.08
60 0.12
61 0.12
62 0.13
63 0.14
64 0.13
65 0.17
66 0.24
67 0.26
68 0.32
69 0.41
70 0.4
71 0.4
72 0.46
73 0.46
74 0.47
75 0.55
76 0.55
77 0.51
78 0.55
79 0.56
80 0.57
81 0.55
82 0.49
83 0.4
84 0.33
85 0.28
86 0.25
87 0.24
88 0.17
89 0.13
90 0.1
91 0.09
92 0.06
93 0.05
94 0.03
95 0.03
96 0.04
97 0.04
98 0.05
99 0.05
100 0.06
101 0.07
102 0.11
103 0.13
104 0.18
105 0.2
106 0.22
107 0.23
108 0.24
109 0.24
110 0.22
111 0.23
112 0.19
113 0.17
114 0.2
115 0.2
116 0.23
117 0.23
118 0.23
119 0.21
120 0.25
121 0.26
122 0.23
123 0.26
124 0.26
125 0.26
126 0.25
127 0.25
128 0.21
129 0.21
130 0.22
131 0.19
132 0.16
133 0.14
134 0.17
135 0.17
136 0.17
137 0.15
138 0.15
139 0.14
140 0.13
141 0.12
142 0.09
143 0.09
144 0.08