Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VP23

Protein Details
Accession K1VP23   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
155-174NEFKAARKTYHKRNIWAERWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.833, cyto_mito 6.666, mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029012  Helix_hairpin_bin_sf  
IPR009851  Mod_r  
Gene Ontology GO:0000813  C:ESCRT I complex  
GO:0009056  P:catabolic process  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF07200  Mod_r  
PROSITE View protein in PROSITE  
PS51314  VPS37_C  
Amino Acid Sequences MTTPLLQQFPSLASYPPSFLKDLLSSPQLTEAFLFTLPEVQELSSEVERLGRENEELAQKNLALQDELLALRDATAQSYSHAEALKAHWAEIDKAQQGLYQDDMSEKIASAFIDGGAAGSGTASRVDSPAPGHEDGASTKADTQARNQSLDEFINEFKAARKTYHKRNIWAERWSRGEVAWRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.23
5 0.22
6 0.21
7 0.23
8 0.21
9 0.22
10 0.24
11 0.24
12 0.22
13 0.21
14 0.27
15 0.23
16 0.22
17 0.2
18 0.16
19 0.14
20 0.14
21 0.14
22 0.08
23 0.12
24 0.11
25 0.12
26 0.11
27 0.1
28 0.1
29 0.11
30 0.15
31 0.11
32 0.11
33 0.11
34 0.13
35 0.13
36 0.14
37 0.14
38 0.11
39 0.11
40 0.12
41 0.15
42 0.19
43 0.21
44 0.21
45 0.2
46 0.18
47 0.19
48 0.2
49 0.17
50 0.11
51 0.09
52 0.08
53 0.09
54 0.09
55 0.08
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.06
62 0.07
63 0.06
64 0.07
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.1
71 0.11
72 0.15
73 0.14
74 0.13
75 0.12
76 0.13
77 0.14
78 0.15
79 0.16
80 0.11
81 0.12
82 0.12
83 0.12
84 0.12
85 0.12
86 0.11
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.08
93 0.08
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.05
100 0.05
101 0.05
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.05
114 0.07
115 0.08
116 0.11
117 0.15
118 0.15
119 0.15
120 0.15
121 0.16
122 0.16
123 0.16
124 0.14
125 0.1
126 0.11
127 0.15
128 0.18
129 0.18
130 0.22
131 0.3
132 0.32
133 0.34
134 0.34
135 0.31
136 0.3
137 0.31
138 0.27
139 0.2
140 0.18
141 0.18
142 0.18
143 0.16
144 0.17
145 0.22
146 0.22
147 0.24
148 0.34
149 0.41
150 0.52
151 0.62
152 0.65
153 0.67
154 0.76
155 0.82
156 0.78
157 0.79
158 0.74
159 0.71
160 0.7
161 0.64
162 0.55
163 0.45
164 0.48