Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z425

Protein Details
Accession A0A4P9Z425    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-108REIYKREKAKWEAKRQAPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MSATTVTTTTTTTPEHTRQNSATFRLDEERVQENYRFGKAIDDLWRCYTVGYHVLDYYRYGYRRSCADKWDHVKFCMKINTMSEEEKQREIYKREKAKWEAKRQAPNLADIWEERRQARHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.35
3 0.37
4 0.41
5 0.41
6 0.48
7 0.48
8 0.46
9 0.46
10 0.38
11 0.38
12 0.36
13 0.35
14 0.29
15 0.28
16 0.29
17 0.27
18 0.29
19 0.27
20 0.26
21 0.27
22 0.27
23 0.23
24 0.19
25 0.19
26 0.17
27 0.2
28 0.24
29 0.24
30 0.25
31 0.27
32 0.27
33 0.25
34 0.24
35 0.2
36 0.14
37 0.15
38 0.15
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.14
45 0.13
46 0.13
47 0.14
48 0.14
49 0.16
50 0.21
51 0.26
52 0.26
53 0.27
54 0.31
55 0.38
56 0.43
57 0.5
58 0.47
59 0.43
60 0.47
61 0.44
62 0.44
63 0.42
64 0.37
65 0.31
66 0.31
67 0.34
68 0.3
69 0.32
70 0.3
71 0.3
72 0.31
73 0.3
74 0.31
75 0.31
76 0.35
77 0.37
78 0.42
79 0.45
80 0.52
81 0.57
82 0.63
83 0.66
84 0.7
85 0.76
86 0.79
87 0.79
88 0.78
89 0.82
90 0.76
91 0.77
92 0.68
93 0.62
94 0.53
95 0.44
96 0.37
97 0.29
98 0.32
99 0.28
100 0.3
101 0.29