Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YRH9

Protein Details
Accession A0A4P9YRH9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-77VPVDVRPRSARKKRTPKTVSKSRAGHydrophilic
NLS Segment(s)
PositionSequence
59-75PRSARKKRTPKTVSKSR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025762  DFDF  
IPR019050  FDF_dom  
Pfam View protein in Pfam  
PF09532  FDF  
PROSITE View protein in PROSITE  
PS51512  DFDF  
Amino Acid Sequences MTEAFIGLTVELTLNDGFTVQGIVSMVNPATQRLQLEHDRAETPLTEATDSDVPVDVRPRSARKKRTPKTVSKSRAGSHRHTTSDANEWAAGDVNEFIEEDFDFQQNLILFDKKKVFEEIRETDNTAPEDRLVSHNRREGRSRNLLPTENVLSRASPEEETDNGSDGEPWRDNNERRSYTFKTTDGSPCWAVTGVQMLEVERMAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.07
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.08
14 0.1
15 0.1
16 0.11
17 0.13
18 0.14
19 0.15
20 0.16
21 0.22
22 0.24
23 0.28
24 0.29
25 0.3
26 0.29
27 0.28
28 0.27
29 0.22
30 0.18
31 0.17
32 0.15
33 0.13
34 0.12
35 0.14
36 0.15
37 0.14
38 0.13
39 0.12
40 0.12
41 0.12
42 0.16
43 0.14
44 0.16
45 0.2
46 0.27
47 0.36
48 0.45
49 0.55
50 0.62
51 0.73
52 0.77
53 0.84
54 0.85
55 0.85
56 0.86
57 0.86
58 0.82
59 0.77
60 0.74
61 0.66
62 0.66
63 0.6
64 0.56
65 0.54
66 0.52
67 0.47
68 0.45
69 0.43
70 0.37
71 0.37
72 0.32
73 0.25
74 0.2
75 0.18
76 0.16
77 0.15
78 0.12
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.08
93 0.08
94 0.09
95 0.08
96 0.1
97 0.1
98 0.13
99 0.17
100 0.16
101 0.17
102 0.2
103 0.2
104 0.21
105 0.28
106 0.28
107 0.29
108 0.29
109 0.3
110 0.26
111 0.28
112 0.26
113 0.2
114 0.17
115 0.13
116 0.13
117 0.13
118 0.17
119 0.2
120 0.22
121 0.26
122 0.31
123 0.35
124 0.38
125 0.42
126 0.43
127 0.46
128 0.52
129 0.51
130 0.53
131 0.53
132 0.52
133 0.47
134 0.46
135 0.42
136 0.33
137 0.31
138 0.25
139 0.2
140 0.2
141 0.21
142 0.19
143 0.15
144 0.16
145 0.16
146 0.16
147 0.19
148 0.18
149 0.17
150 0.16
151 0.15
152 0.15
153 0.14
154 0.18
155 0.17
156 0.17
157 0.21
158 0.28
159 0.32
160 0.39
161 0.47
162 0.47
163 0.49
164 0.56
165 0.56
166 0.57
167 0.58
168 0.51
169 0.44
170 0.45
171 0.48
172 0.44
173 0.44
174 0.37
175 0.32
176 0.32
177 0.29
178 0.24
179 0.18
180 0.21
181 0.16
182 0.15
183 0.16
184 0.15
185 0.15
186 0.15