Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z337

Protein Details
Accession A0A4P9Z337    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
4-26LYCKGRIQGFKRGKRNQSPDTTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MCSLYCKGRIQGFKRGKRNQSPDTTLIRIENVQCKEDATFYLGKRVAYVYRAQKETNGSKYRVIWGRVMRVHGNSGIVKAKFRTNLPAKTFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.8
4 0.81
5 0.85
6 0.82
7 0.8
8 0.77
9 0.72
10 0.69
11 0.61
12 0.52
13 0.44
14 0.37
15 0.3
16 0.27
17 0.28
18 0.24
19 0.23
20 0.22
21 0.22
22 0.21
23 0.2
24 0.17
25 0.13
26 0.15
27 0.14
28 0.21
29 0.21
30 0.2
31 0.2
32 0.21
33 0.18
34 0.16
35 0.21
36 0.22
37 0.25
38 0.27
39 0.27
40 0.28
41 0.32
42 0.35
43 0.38
44 0.35
45 0.32
46 0.33
47 0.33
48 0.38
49 0.37
50 0.34
51 0.31
52 0.3
53 0.35
54 0.35
55 0.38
56 0.34
57 0.3
58 0.3
59 0.25
60 0.25
61 0.19
62 0.2
63 0.22
64 0.2
65 0.21
66 0.21
67 0.25
68 0.25
69 0.26
70 0.34
71 0.36
72 0.44
73 0.47
74 0.52
75 0.49
76 0.48
77 0.47
78 0.38
79 0.34
80 0.26
81 0.22
82 0.17
83 0.17
84 0.16