Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YVM1

Protein Details
Accession A0A4P9YVM1   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
178-198DMLNFYLGQKKKKKQKKSAKPHydrophilic
NLS Segment(s)
PositionSequence
187-198KKKKKQKKSAKP
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MATSSSSSTPRTDATPSDAPTDLDMLRTRLEVSVGMARSLVASWLPTEDDQHESATADHTAADNSGQNRDDGRMFAGMTARARRLGLGAKYLSHRQATQAPAHKGMLSEDKLRRKLLGNQRSSGDSAASATKKSASARTGDKRTAVDDESDDEAEERKGASNSANRTDKRAATGHGHDMLNFYLGQKKKKKQKKSAKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.32
4 0.34
5 0.33
6 0.31
7 0.29
8 0.29
9 0.22
10 0.19
11 0.19
12 0.17
13 0.17
14 0.17
15 0.16
16 0.14
17 0.15
18 0.12
19 0.13
20 0.17
21 0.17
22 0.16
23 0.15
24 0.15
25 0.14
26 0.14
27 0.11
28 0.06
29 0.06
30 0.06
31 0.07
32 0.09
33 0.09
34 0.11
35 0.12
36 0.15
37 0.15
38 0.16
39 0.15
40 0.14
41 0.14
42 0.14
43 0.12
44 0.09
45 0.08
46 0.08
47 0.08
48 0.07
49 0.08
50 0.09
51 0.09
52 0.12
53 0.12
54 0.13
55 0.13
56 0.15
57 0.15
58 0.12
59 0.13
60 0.11
61 0.1
62 0.11
63 0.11
64 0.11
65 0.12
66 0.14
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.16
73 0.14
74 0.16
75 0.16
76 0.16
77 0.19
78 0.21
79 0.21
80 0.18
81 0.17
82 0.16
83 0.2
84 0.21
85 0.24
86 0.29
87 0.29
88 0.29
89 0.29
90 0.27
91 0.23
92 0.22
93 0.22
94 0.17
95 0.22
96 0.25
97 0.31
98 0.33
99 0.34
100 0.34
101 0.32
102 0.39
103 0.43
104 0.47
105 0.45
106 0.44
107 0.45
108 0.46
109 0.43
110 0.35
111 0.24
112 0.15
113 0.12
114 0.14
115 0.13
116 0.12
117 0.11
118 0.12
119 0.14
120 0.15
121 0.19
122 0.16
123 0.2
124 0.28
125 0.36
126 0.4
127 0.4
128 0.41
129 0.37
130 0.38
131 0.37
132 0.3
133 0.23
134 0.19
135 0.2
136 0.2
137 0.19
138 0.17
139 0.14
140 0.14
141 0.12
142 0.12
143 0.09
144 0.09
145 0.1
146 0.1
147 0.15
148 0.2
149 0.25
150 0.34
151 0.41
152 0.39
153 0.45
154 0.5
155 0.46
156 0.45
157 0.43
158 0.38
159 0.37
160 0.41
161 0.4
162 0.4
163 0.39
164 0.34
165 0.33
166 0.3
167 0.24
168 0.2
169 0.16
170 0.18
171 0.22
172 0.31
173 0.39
174 0.48
175 0.58
176 0.68
177 0.78
178 0.82