Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z445

Protein Details
Accession A0A4P9Z445    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42KGSSTGGIKKKSKKKKKERERERMAEALBasic
NLS Segment(s)
PositionSequence
19-37TGGIKKKSKKKKKERERER
73-89RKREEERIKKAAAKSHK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.833, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDYDLTIRSSLKLKGSSTGGIKKKSKKKKKERERERMAEALKQASIDSGETYQQEHDDGKTPAERRFEEVQRKREEERIKKAAAKSHKEKVAEFNEYLGNLSEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.31
4 0.33
5 0.36
6 0.41
7 0.42
8 0.46
9 0.52
10 0.58
11 0.65
12 0.72
13 0.77
14 0.8
15 0.85
16 0.88
17 0.93
18 0.94
19 0.95
20 0.95
21 0.95
22 0.9
23 0.84
24 0.79
25 0.69
26 0.61
27 0.51
28 0.41
29 0.31
30 0.24
31 0.19
32 0.13
33 0.12
34 0.08
35 0.08
36 0.07
37 0.08
38 0.08
39 0.09
40 0.08
41 0.08
42 0.09
43 0.08
44 0.08
45 0.11
46 0.11
47 0.11
48 0.15
49 0.17
50 0.2
51 0.24
52 0.23
53 0.25
54 0.31
55 0.37
56 0.44
57 0.5
58 0.54
59 0.56
60 0.59
61 0.56
62 0.57
63 0.6
64 0.58
65 0.6
66 0.58
67 0.55
68 0.57
69 0.58
70 0.58
71 0.58
72 0.58
73 0.55
74 0.58
75 0.6
76 0.57
77 0.55
78 0.56
79 0.54
80 0.5
81 0.43
82 0.37
83 0.33
84 0.31
85 0.31
86 0.23
87 0.17
88 0.12
89 0.14
90 0.13
91 0.12
92 0.14
93 0.15
94 0.14