Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YZ67

Protein Details
Accession A0A4P9YZ67    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
220-255PATPSPPPKKCAKKKYPRKPKKCHKKPYPATPVPPPBasic
NLS Segment(s)
PositionSequence
226-245PPKKCAKKKYPRKPKKCHKK
Subcellular Location(s) extr 23, mito 3
Family & Domain DBs
Amino Acid Sequences MKGVYAALTLAFVASAAASPSFIRRSYVSAPPPAGQQPSTTPSTPSTPSTPAPGNVYVPAPGYDTVPPPSTPATPGGEQPATPGTPATPLTPSTPATGGEQPATPAPGYDTVPPPSTPGGEQPATPAPGYNTTTPGYNTTVPGGELPNTNTTVPGGELPNTNTTVPATPITPATPGGEQPATPATPITPSTPAPAPGYGEVPATPSPPPAGHEDFNTTVPATPSPPPKKCAKKKYPRKPKKCHKKPYPATPVPPPSGNEDFNKETPATPAPPPVTPVTPAPPPSVPAPPPVTPITPVTPPPSTPAPAPGGELPNTNTTVPCNETTPGGELPSTNTTVPAPCNCTVPVPPTNNTTPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.05
5 0.06
6 0.07
7 0.11
8 0.15
9 0.15
10 0.18
11 0.18
12 0.24
13 0.29
14 0.37
15 0.38
16 0.41
17 0.44
18 0.42
19 0.45
20 0.43
21 0.42
22 0.34
23 0.31
24 0.29
25 0.31
26 0.35
27 0.31
28 0.29
29 0.29
30 0.32
31 0.33
32 0.31
33 0.31
34 0.3
35 0.31
36 0.34
37 0.34
38 0.31
39 0.33
40 0.31
41 0.29
42 0.26
43 0.26
44 0.22
45 0.2
46 0.18
47 0.16
48 0.14
49 0.15
50 0.15
51 0.16
52 0.19
53 0.2
54 0.19
55 0.19
56 0.21
57 0.2
58 0.2
59 0.21
60 0.22
61 0.21
62 0.23
63 0.26
64 0.24
65 0.23
66 0.23
67 0.22
68 0.18
69 0.17
70 0.16
71 0.11
72 0.13
73 0.14
74 0.14
75 0.12
76 0.14
77 0.16
78 0.19
79 0.19
80 0.19
81 0.19
82 0.18
83 0.2
84 0.21
85 0.2
86 0.18
87 0.17
88 0.16
89 0.16
90 0.16
91 0.12
92 0.1
93 0.1
94 0.11
95 0.13
96 0.15
97 0.17
98 0.19
99 0.22
100 0.21
101 0.22
102 0.2
103 0.2
104 0.17
105 0.17
106 0.19
107 0.18
108 0.18
109 0.19
110 0.21
111 0.21
112 0.2
113 0.18
114 0.14
115 0.18
116 0.2
117 0.18
118 0.18
119 0.17
120 0.18
121 0.18
122 0.19
123 0.18
124 0.16
125 0.16
126 0.14
127 0.14
128 0.13
129 0.13
130 0.12
131 0.1
132 0.1
133 0.11
134 0.12
135 0.13
136 0.13
137 0.12
138 0.11
139 0.1
140 0.1
141 0.1
142 0.08
143 0.08
144 0.09
145 0.11
146 0.13
147 0.14
148 0.14
149 0.12
150 0.12
151 0.11
152 0.12
153 0.1
154 0.09
155 0.08
156 0.09
157 0.09
158 0.09
159 0.09
160 0.09
161 0.09
162 0.08
163 0.1
164 0.1
165 0.1
166 0.1
167 0.11
168 0.1
169 0.09
170 0.09
171 0.07
172 0.08
173 0.09
174 0.1
175 0.1
176 0.11
177 0.13
178 0.14
179 0.16
180 0.15
181 0.15
182 0.14
183 0.13
184 0.13
185 0.11
186 0.11
187 0.09
188 0.1
189 0.1
190 0.11
191 0.1
192 0.09
193 0.1
194 0.1
195 0.12
196 0.15
197 0.18
198 0.17
199 0.19
200 0.22
201 0.23
202 0.23
203 0.22
204 0.17
205 0.14
206 0.14
207 0.14
208 0.12
209 0.15
210 0.24
211 0.32
212 0.34
213 0.37
214 0.45
215 0.56
216 0.63
217 0.7
218 0.72
219 0.75
220 0.83
221 0.91
222 0.94
223 0.94
224 0.95
225 0.95
226 0.95
227 0.96
228 0.95
229 0.95
230 0.95
231 0.95
232 0.93
233 0.93
234 0.93
235 0.88
236 0.81
237 0.79
238 0.74
239 0.66
240 0.59
241 0.49
242 0.45
243 0.42
244 0.4
245 0.34
246 0.33
247 0.35
248 0.33
249 0.34
250 0.28
251 0.24
252 0.24
253 0.25
254 0.23
255 0.2
256 0.25
257 0.25
258 0.25
259 0.27
260 0.27
261 0.25
262 0.24
263 0.25
264 0.23
265 0.25
266 0.27
267 0.28
268 0.25
269 0.26
270 0.27
271 0.3
272 0.27
273 0.29
274 0.32
275 0.3
276 0.33
277 0.34
278 0.32
279 0.28
280 0.31
281 0.28
282 0.26
283 0.27
284 0.28
285 0.27
286 0.26
287 0.29
288 0.3
289 0.28
290 0.26
291 0.29
292 0.28
293 0.26
294 0.29
295 0.28
296 0.28
297 0.27
298 0.28
299 0.25
300 0.25
301 0.26
302 0.23
303 0.2
304 0.18
305 0.21
306 0.23
307 0.22
308 0.21
309 0.2
310 0.22
311 0.23
312 0.25
313 0.22
314 0.2
315 0.19
316 0.16
317 0.2
318 0.22
319 0.23
320 0.19
321 0.19
322 0.19
323 0.22
324 0.26
325 0.26
326 0.28
327 0.27
328 0.3
329 0.3
330 0.32
331 0.33
332 0.35
333 0.38
334 0.38
335 0.4
336 0.43