Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1V483

Protein Details
Accession K1V483    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
119-139IASLKKFRRQRRVVLKELKKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPSRTQSPNPTMDILSSVRRIDTSLKTQNHSRYAVQHELANLREATTRMQQLLYKSVKYMMERNTFASNLEEVKIDIDDTTAKIRELQEKEKAAKNEGTPEAMSEFNTKYGETLEEHIASLKKFRRQRRVVLKELKKLDAKAEKVVESCQKVLGDEEATRTARHIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.26
4 0.25
5 0.22
6 0.2
7 0.2
8 0.21
9 0.23
10 0.26
11 0.3
12 0.37
13 0.4
14 0.43
15 0.5
16 0.55
17 0.55
18 0.52
19 0.46
20 0.43
21 0.46
22 0.48
23 0.42
24 0.37
25 0.34
26 0.33
27 0.32
28 0.28
29 0.21
30 0.16
31 0.17
32 0.16
33 0.17
34 0.18
35 0.19
36 0.18
37 0.19
38 0.2
39 0.2
40 0.28
41 0.27
42 0.23
43 0.22
44 0.25
45 0.26
46 0.26
47 0.29
48 0.28
49 0.32
50 0.32
51 0.34
52 0.33
53 0.3
54 0.29
55 0.25
56 0.18
57 0.13
58 0.13
59 0.1
60 0.08
61 0.09
62 0.08
63 0.07
64 0.06
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.07
71 0.09
72 0.11
73 0.18
74 0.21
75 0.25
76 0.29
77 0.32
78 0.35
79 0.38
80 0.38
81 0.33
82 0.33
83 0.3
84 0.3
85 0.27
86 0.26
87 0.21
88 0.2
89 0.19
90 0.16
91 0.16
92 0.13
93 0.12
94 0.12
95 0.13
96 0.12
97 0.11
98 0.11
99 0.12
100 0.11
101 0.13
102 0.14
103 0.14
104 0.14
105 0.16
106 0.16
107 0.15
108 0.2
109 0.22
110 0.28
111 0.35
112 0.45
113 0.53
114 0.58
115 0.69
116 0.74
117 0.77
118 0.79
119 0.82
120 0.81
121 0.79
122 0.77
123 0.73
124 0.65
125 0.58
126 0.56
127 0.54
128 0.48
129 0.46
130 0.45
131 0.42
132 0.39
133 0.43
134 0.42
135 0.37
136 0.35
137 0.32
138 0.29
139 0.28
140 0.28
141 0.26
142 0.22
143 0.19
144 0.22
145 0.24
146 0.24
147 0.24