Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YTR9

Protein Details
Accession A0A4P9YTR9    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-28PASSGGSRPRRNRRVITQTRKVQPIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9plas 9, nucl 4, cyto 2, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR003888  FYrich_N  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05964  FYRN  
PROSITE View protein in PROSITE  
PS51542  FYRN  
Amino Acid Sequences MTRPASSGGSRPRRNRRVITQTRKVQPIPRDADGRPILPVQVGILTVINLGTVVHDREAFHNERYIWPVGYTVQRPYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.79
4 0.8
5 0.83
6 0.83
7 0.82
8 0.82
9 0.81
10 0.78
11 0.71
12 0.66
13 0.6
14 0.59
15 0.54
16 0.49
17 0.46
18 0.41
19 0.46
20 0.41
21 0.36
22 0.28
23 0.23
24 0.19
25 0.15
26 0.15
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.04
39 0.05
40 0.06
41 0.07
42 0.08
43 0.09
44 0.11
45 0.17
46 0.19
47 0.19
48 0.23
49 0.23
50 0.25
51 0.28
52 0.28
53 0.23
54 0.21
55 0.21
56 0.21
57 0.26
58 0.26