Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z0M9

Protein Details
Accession A0A4P9Z0M9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-72ATCMKNLPKKSKKTSSINYHLARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPQSLKYLRVRPRKIIQGSPCVTEMVAMLNCWGISAPDDPKCAETAKALATCMKNLPKKSKKTSSINYHLARLGKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.69
4 0.68
5 0.64
6 0.58
7 0.51
8 0.41
9 0.35
10 0.26
11 0.2
12 0.13
13 0.11
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.07
20 0.04
21 0.05
22 0.07
23 0.1
24 0.11
25 0.13
26 0.13
27 0.14
28 0.15
29 0.14
30 0.13
31 0.11
32 0.11
33 0.13
34 0.13
35 0.13
36 0.16
37 0.16
38 0.17
39 0.21
40 0.27
41 0.3
42 0.35
43 0.45
44 0.5
45 0.59
46 0.67
47 0.72
48 0.74
49 0.78
50 0.82
51 0.82
52 0.82
53 0.82
54 0.75
55 0.68
56 0.63
57 0.56