Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YY72

Protein Details
Accession A0A4P9YY72    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-62KYEKQRQCKRTVLKLKNQLRQTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, extr 6, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028945  Get1  
IPR029012  Helix_hairpin_bin_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0071816  P:tail-anchored membrane protein insertion into ER membrane  
Pfam View protein in Pfam  
PF04420  CHD5  
Amino Acid Sequences MQLATLILLLVITSAWIHIIGYGRLGLKLYEWRRQLLKSGKYEKQRQCKRTVLKLKNQLRQTSPHDEFAKWAKIRRRLDKTVSEYEELSSSLAYERTGFQIRAAIGIRVLLWAARFFVLIWYRAEPVFYPPTGWLDPVLPLLSFPLAPYGSVSVAVWLLVCTQVVDLCLRAYRVVQPESGAVPVITTTAPAADAGANSGMEGIRLDEKHRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.06
6 0.09
7 0.09
8 0.1
9 0.12
10 0.12
11 0.13
12 0.14
13 0.12
14 0.12
15 0.21
16 0.24
17 0.3
18 0.31
19 0.35
20 0.38
21 0.4
22 0.46
23 0.46
24 0.5
25 0.51
26 0.58
27 0.61
28 0.66
29 0.75
30 0.75
31 0.77
32 0.79
33 0.76
34 0.75
35 0.78
36 0.76
37 0.77
38 0.79
39 0.77
40 0.76
41 0.81
42 0.82
43 0.8
44 0.78
45 0.73
46 0.65
47 0.62
48 0.59
49 0.58
50 0.52
51 0.51
52 0.48
53 0.43
54 0.42
55 0.41
56 0.42
57 0.34
58 0.37
59 0.38
60 0.45
61 0.53
62 0.6
63 0.63
64 0.61
65 0.66
66 0.68
67 0.67
68 0.66
69 0.61
70 0.52
71 0.44
72 0.38
73 0.33
74 0.24
75 0.18
76 0.1
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.09
84 0.11
85 0.11
86 0.11
87 0.13
88 0.13
89 0.14
90 0.14
91 0.11
92 0.09
93 0.09
94 0.09
95 0.06
96 0.06
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.05
104 0.08
105 0.1
106 0.11
107 0.12
108 0.12
109 0.13
110 0.13
111 0.14
112 0.11
113 0.14
114 0.15
115 0.14
116 0.13
117 0.13
118 0.17
119 0.17
120 0.17
121 0.13
122 0.11
123 0.12
124 0.12
125 0.12
126 0.08
127 0.07
128 0.08
129 0.08
130 0.07
131 0.06
132 0.08
133 0.08
134 0.08
135 0.09
136 0.09
137 0.09
138 0.1
139 0.09
140 0.07
141 0.07
142 0.07
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.06
152 0.07
153 0.07
154 0.08
155 0.09
156 0.09
157 0.1
158 0.11
159 0.16
160 0.21
161 0.22
162 0.22
163 0.22
164 0.23
165 0.23
166 0.23
167 0.17
168 0.11
169 0.1
170 0.09
171 0.09
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.08
182 0.09
183 0.09
184 0.08
185 0.09
186 0.08
187 0.07
188 0.08
189 0.08
190 0.13
191 0.14