Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1J1F2

Protein Details
Accession A0A4V1J1F2   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-118KSAPKKTKKGVKHGGNKKGKBasic
151-194EEPKKKQGGKKHGKKSGSKKSGSNKKKKKNDSGKKNGGKDKPKHBasic
NLS Segment(s)
PositionSequence
101-120APKKTKKGVKHGGNKKGKGK
153-194PKKKQGGKKHGKKSGSKKSGSNKKKKKNDSGKKNGGKDKPKH
Subcellular Location(s) mito 17.5, mito_nucl 13.166, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences QGRRIHTLVKACNRVTLSFKITKAYPGDCKLYVLDKNYGQPQLIATKPSCGVRTGTIPWTVELPAQLSGSKVLRWVWEAKRTDGQTCNVEMCHDIEITKSAPKKTKKGVKHGGNKKGKGKDGDSDSKSGSSSGSSGSSNDSSNDSSSESAEEPKKKQGGKKHGKKSGSKKSGSNKKKKKNDSGKKNGGKDKPKHGGGLYSNEPAYPLPGASNSNGGLPLCTRETSVPLAFLGMWRGHQYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.45
4 0.42
5 0.41
6 0.41
7 0.39
8 0.38
9 0.4
10 0.39
11 0.38
12 0.39
13 0.37
14 0.41
15 0.38
16 0.38
17 0.35
18 0.36
19 0.35
20 0.32
21 0.32
22 0.3
23 0.34
24 0.37
25 0.37
26 0.31
27 0.28
28 0.26
29 0.27
30 0.26
31 0.26
32 0.21
33 0.23
34 0.25
35 0.27
36 0.26
37 0.21
38 0.22
39 0.2
40 0.24
41 0.25
42 0.26
43 0.26
44 0.25
45 0.24
46 0.24
47 0.22
48 0.18
49 0.15
50 0.13
51 0.11
52 0.11
53 0.11
54 0.1
55 0.12
56 0.12
57 0.12
58 0.12
59 0.12
60 0.12
61 0.15
62 0.21
63 0.23
64 0.31
65 0.33
66 0.34
67 0.4
68 0.4
69 0.42
70 0.38
71 0.37
72 0.31
73 0.3
74 0.28
75 0.21
76 0.2
77 0.17
78 0.14
79 0.12
80 0.1
81 0.08
82 0.08
83 0.09
84 0.1
85 0.13
86 0.15
87 0.17
88 0.24
89 0.29
90 0.35
91 0.42
92 0.5
93 0.53
94 0.61
95 0.67
96 0.69
97 0.75
98 0.79
99 0.8
100 0.79
101 0.77
102 0.74
103 0.69
104 0.63
105 0.56
106 0.49
107 0.43
108 0.42
109 0.45
110 0.39
111 0.36
112 0.33
113 0.3
114 0.28
115 0.23
116 0.16
117 0.09
118 0.08
119 0.07
120 0.08
121 0.08
122 0.08
123 0.1
124 0.11
125 0.11
126 0.11
127 0.12
128 0.12
129 0.12
130 0.13
131 0.11
132 0.1
133 0.1
134 0.11
135 0.1
136 0.13
137 0.18
138 0.22
139 0.23
140 0.28
141 0.33
142 0.35
143 0.4
144 0.45
145 0.51
146 0.58
147 0.67
148 0.71
149 0.74
150 0.77
151 0.81
152 0.82
153 0.82
154 0.8
155 0.73
156 0.7
157 0.72
158 0.77
159 0.78
160 0.79
161 0.78
162 0.8
163 0.87
164 0.89
165 0.9
166 0.9
167 0.91
168 0.91
169 0.91
170 0.92
171 0.9
172 0.89
173 0.87
174 0.84
175 0.83
176 0.79
177 0.78
178 0.75
179 0.69
180 0.64
181 0.56
182 0.54
183 0.48
184 0.48
185 0.41
186 0.36
187 0.34
188 0.3
189 0.3
190 0.23
191 0.21
192 0.15
193 0.11
194 0.09
195 0.11
196 0.14
197 0.14
198 0.17
199 0.15
200 0.16
201 0.17
202 0.16
203 0.15
204 0.14
205 0.16
206 0.16
207 0.16
208 0.17
209 0.17
210 0.2
211 0.25
212 0.25
213 0.22
214 0.19
215 0.2
216 0.18
217 0.18
218 0.18
219 0.14
220 0.15