Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YVD3

Protein Details
Accession A0A4P9YVD3   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-44TLSSGQLFKRWRKKNKPVQELIFKDHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 8, nucl 6.5, cyto_nucl 6.5, cyto 5.5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040979  Vid27_N  
Pfam View protein in Pfam  
PF17748  VID27_N  
Amino Acid Sequences MFKTIGSLIWGGEQDPTVATLSSGQLFKRWRKKNKPVQELIFKDAQAAIRRTSTRFQYQLVVTPVYKEGEEALLEEQGQELPDDYVQLLDAELNLYMEQADGITTFTWRQPSSVGVLSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.09
5 0.08
6 0.08
7 0.09
8 0.1
9 0.12
10 0.13
11 0.12
12 0.16
13 0.23
14 0.31
15 0.4
16 0.49
17 0.57
18 0.67
19 0.78
20 0.84
21 0.89
22 0.9
23 0.88
24 0.85
25 0.84
26 0.77
27 0.69
28 0.6
29 0.49
30 0.4
31 0.33
32 0.29
33 0.23
34 0.21
35 0.19
36 0.2
37 0.21
38 0.23
39 0.25
40 0.26
41 0.27
42 0.27
43 0.27
44 0.27
45 0.26
46 0.28
47 0.27
48 0.24
49 0.19
50 0.18
51 0.18
52 0.15
53 0.14
54 0.09
55 0.08
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.08
93 0.1
94 0.16
95 0.16
96 0.17
97 0.17
98 0.19
99 0.23
100 0.26