Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VKP8

Protein Details
Accession K1VKP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
214-240VDTPPNAKGKQKEKPKQKTQADLDEEMHydrophilic
NLS Segment(s)
PositionSequence
113-230KKLAAKAKPAAPKKDDGKAPGLKLLSRLGKGGKAGEQQKQKLLLEKQRAALKKKGSPGDVLASRLGKSKPGAKSAAGKKAAAKAPAGGAAKVARAKKDKMDVDTPPNAKGKQKEKPKQ
Subcellular Location(s) cyto 16, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MPSVLLFSGLPLDVREPDLAELLVAEPVRLAPSSVAVTALHNGKGVFLGTFLVEVGTDVDAERVRKQFSGQLIDGSHTLSVHHVLPATHPHPSVAPPASITSRVTPMMAQQPKKLAAKAKPAAPKKDDGKAPGLKLLSRLGKGGKAGEQQKQKLLLEKQRAALKKKGSPGDVLASRLGKSKPGAKSAAGKKAAAKAPAGGAAKVARAKKDKMDVDTPPNAKGKQKEKPKQKTQADLDEEMRAYERQRRFAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.14
5 0.15
6 0.14
7 0.12
8 0.11
9 0.09
10 0.11
11 0.1
12 0.08
13 0.07
14 0.08
15 0.09
16 0.09
17 0.09
18 0.07
19 0.09
20 0.11
21 0.11
22 0.12
23 0.11
24 0.12
25 0.15
26 0.17
27 0.15
28 0.15
29 0.14
30 0.13
31 0.14
32 0.13
33 0.09
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.07
47 0.08
48 0.1
49 0.14
50 0.16
51 0.17
52 0.17
53 0.19
54 0.22
55 0.25
56 0.3
57 0.26
58 0.27
59 0.26
60 0.27
61 0.25
62 0.21
63 0.17
64 0.1
65 0.1
66 0.08
67 0.09
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.16
74 0.17
75 0.17
76 0.17
77 0.17
78 0.17
79 0.18
80 0.22
81 0.16
82 0.15
83 0.14
84 0.16
85 0.16
86 0.17
87 0.17
88 0.13
89 0.14
90 0.14
91 0.14
92 0.12
93 0.13
94 0.21
95 0.25
96 0.25
97 0.25
98 0.28
99 0.32
100 0.33
101 0.32
102 0.29
103 0.29
104 0.37
105 0.38
106 0.42
107 0.45
108 0.49
109 0.52
110 0.48
111 0.49
112 0.42
113 0.45
114 0.41
115 0.35
116 0.37
117 0.35
118 0.34
119 0.31
120 0.29
121 0.23
122 0.23
123 0.24
124 0.2
125 0.17
126 0.18
127 0.16
128 0.17
129 0.17
130 0.17
131 0.16
132 0.19
133 0.22
134 0.27
135 0.33
136 0.33
137 0.36
138 0.38
139 0.35
140 0.37
141 0.39
142 0.4
143 0.42
144 0.43
145 0.44
146 0.47
147 0.51
148 0.49
149 0.49
150 0.47
151 0.44
152 0.48
153 0.49
154 0.44
155 0.41
156 0.39
157 0.39
158 0.35
159 0.31
160 0.27
161 0.23
162 0.22
163 0.24
164 0.22
165 0.19
166 0.19
167 0.25
168 0.26
169 0.3
170 0.32
171 0.3
172 0.39
173 0.43
174 0.5
175 0.45
176 0.42
177 0.4
178 0.46
179 0.47
180 0.39
181 0.33
182 0.25
183 0.24
184 0.29
185 0.27
186 0.2
187 0.18
188 0.17
189 0.19
190 0.23
191 0.24
192 0.25
193 0.28
194 0.32
195 0.36
196 0.44
197 0.46
198 0.47
199 0.51
200 0.51
201 0.53
202 0.59
203 0.54
204 0.49
205 0.5
206 0.46
207 0.46
208 0.49
209 0.5
210 0.51
211 0.61
212 0.67
213 0.73
214 0.82
215 0.86
216 0.89
217 0.88
218 0.89
219 0.85
220 0.85
221 0.8
222 0.74
223 0.66
224 0.59
225 0.51
226 0.42
227 0.36
228 0.27
229 0.24
230 0.28
231 0.31
232 0.34