Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YS78

Protein Details
Accession A0A4P9YS78    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTRPASSGGSRPRRNRRVITQTRKVQPIPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 6, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003888  FYrich_N  
IPR040092  TBRG1  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05964  FYRN  
PROSITE View protein in PROSITE  
PS51542  FYRN  
Amino Acid Sequences MTRPASSGGSRPRRNRRVITQTRKVQPIPRDADGRPILPVQVGILTVINLGTVVHDREAFHNERYIWPVGYTVQRPYASMKYPDKQTIYTCSVRDGIDGPKRVENKQQQAFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.81
4 0.81
5 0.84
6 0.84
7 0.83
8 0.84
9 0.83
10 0.8
11 0.73
12 0.69
13 0.64
14 0.63
15 0.58
16 0.53
17 0.5
18 0.45
19 0.5
20 0.45
21 0.39
22 0.31
23 0.26
24 0.22
25 0.18
26 0.17
27 0.09
28 0.07
29 0.07
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.06
43 0.07
44 0.08
45 0.13
46 0.14
47 0.14
48 0.16
49 0.17
50 0.17
51 0.2
52 0.2
53 0.16
54 0.14
55 0.14
56 0.13
57 0.17
58 0.17
59 0.16
60 0.2
61 0.2
62 0.2
63 0.24
64 0.26
65 0.26
66 0.31
67 0.36
68 0.35
69 0.4
70 0.45
71 0.43
72 0.41
73 0.4
74 0.4
75 0.4
76 0.39
77 0.35
78 0.32
79 0.32
80 0.3
81 0.28
82 0.24
83 0.26
84 0.3
85 0.34
86 0.34
87 0.38
88 0.41
89 0.43
90 0.51
91 0.53
92 0.56