Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z3H9

Protein Details
Accession A0A4P9Z3H9    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSKSKNHTNHNQNRKAHRNGIKRPQRFRHAHydrophilic
NLS Segment(s)
PositionSequence
14-34RKAHRNGIKRPQRFRHASRKG
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNRKAHRNGIKRPQRFRHASRKGVDTKFLRNQRFAVRGTIAALERKRQAAKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.79
4 0.78
5 0.77
6 0.78
7 0.8
8 0.81
9 0.8
10 0.82
11 0.8
12 0.8
13 0.77
14 0.75
15 0.75
16 0.73
17 0.72
18 0.66
19 0.65
20 0.63
21 0.57
22 0.56
23 0.48
24 0.47
25 0.48
26 0.53
27 0.5
28 0.45
29 0.47
30 0.46
31 0.48
32 0.42
33 0.38
34 0.31
35 0.29
36 0.28
37 0.28
38 0.23
39 0.26
40 0.26
41 0.26
42 0.28
43 0.33
44 0.34