Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2L7G3

Protein Details
Accession E2L7G3    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21HSRVKQKRPRSRTLTNVHEKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mpr:MPER_01820  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences HSRVKQKRPRSRTLTNVHEKILEDLVFPTEIVGKRTRVSVDGSKLLRVFLDSKDANVLEYKLDSFSSVYRRLTGKDVVFEFPVVAQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.75
4 0.66
5 0.6
6 0.51
7 0.43
8 0.37
9 0.27
10 0.17
11 0.15
12 0.15
13 0.13
14 0.12
15 0.1
16 0.11
17 0.12
18 0.14
19 0.15
20 0.15
21 0.16
22 0.18
23 0.18
24 0.15
25 0.19
26 0.21
27 0.22
28 0.26
29 0.26
30 0.26
31 0.25
32 0.24
33 0.19
34 0.16
35 0.15
36 0.09
37 0.16
38 0.14
39 0.14
40 0.17
41 0.17
42 0.16
43 0.15
44 0.15
45 0.09
46 0.1
47 0.1
48 0.08
49 0.09
50 0.09
51 0.09
52 0.12
53 0.16
54 0.2
55 0.2
56 0.23
57 0.25
58 0.26
59 0.29
60 0.33
61 0.3
62 0.32
63 0.33
64 0.33
65 0.32
66 0.3
67 0.26