Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1J0S4

Protein Details
Accession A0A4V1J0S4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
301-323RPLPWNPSKSKKREKEGVRPIFWHydrophilic
NLS Segment(s)
PositionSequence
309-317KSKKREKEG
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, nucl 8.5, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029041  FAD-linked_oxidoreductase-like  
IPR004621  Fadh2_euk  
IPR003171  Mehydrof_redctse-like  
IPR004620  MTHF_reductase_bac  
Gene Ontology GO:0005829  C:cytosol  
GO:0004489  F:methylenetetrahydrofolate reductase (NAD(P)H) activity  
GO:0009086  P:methionine biosynthetic process  
GO:0035999  P:tetrahydrofolate interconversion  
Pfam View protein in Pfam  
PF02219  MTHFR  
CDD cd00537  MTHFR  
Amino Acid Sequences MKITQKLHKAEAEKRPYWSFEYFPPKTQQGLLNLYDRMERMYRLGPEFIDVTWGAGGSTSDLTLDICGTAQTVYGLETCMHLTCTCMPREKVDMALRECKNNGIQNILALRGDPPRGQDTWEACEGGFVHAADLVRYIRDQYGDYFCIGVAGYPEGHTECESKELDLQYLKEKVDAGADYIVTQLFYDTDLFLDWVDKCRAIGIQCPILPGIMPIQNFNGFKRMTTLSQTAVPQFIYDSLEPIKEDDQAVKDYGITLAIDMCRQMAAKGISGFHFYTMNLERSIRLILEGLGWVAPVEITRPLPWNPSKSKKREKEGVRPIFWKNRARSYIQRTESWDEFPNGRWGDSSSPAFGELDGYGASIKQSRQDAVKLWQHPTTVDEVAALFSRYCRGELSALPWSEQQPNIETDVIREHLVGINQRGYLTINSQPSVNGVKSSDRMFGWGPKNGYVYQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.62
3 0.59
4 0.57
5 0.51
6 0.44
7 0.44
8 0.51
9 0.48
10 0.49
11 0.52
12 0.49
13 0.47
14 0.48
15 0.45
16 0.41
17 0.44
18 0.42
19 0.4
20 0.38
21 0.37
22 0.35
23 0.3
24 0.27
25 0.23
26 0.2
27 0.2
28 0.24
29 0.28
30 0.29
31 0.31
32 0.27
33 0.28
34 0.28
35 0.24
36 0.22
37 0.17
38 0.15
39 0.13
40 0.12
41 0.1
42 0.09
43 0.09
44 0.07
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.06
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.08
64 0.09
65 0.1
66 0.1
67 0.11
68 0.1
69 0.12
70 0.17
71 0.22
72 0.24
73 0.3
74 0.3
75 0.33
76 0.38
77 0.37
78 0.37
79 0.39
80 0.42
81 0.4
82 0.49
83 0.47
84 0.45
85 0.45
86 0.41
87 0.4
88 0.38
89 0.34
90 0.29
91 0.27
92 0.27
93 0.27
94 0.25
95 0.2
96 0.15
97 0.16
98 0.15
99 0.17
100 0.15
101 0.17
102 0.2
103 0.2
104 0.22
105 0.26
106 0.26
107 0.28
108 0.29
109 0.26
110 0.22
111 0.23
112 0.21
113 0.17
114 0.15
115 0.11
116 0.09
117 0.11
118 0.11
119 0.09
120 0.1
121 0.09
122 0.08
123 0.09
124 0.1
125 0.09
126 0.11
127 0.12
128 0.13
129 0.18
130 0.18
131 0.18
132 0.17
133 0.15
134 0.15
135 0.14
136 0.1
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.08
144 0.09
145 0.1
146 0.09
147 0.13
148 0.13
149 0.13
150 0.16
151 0.16
152 0.16
153 0.17
154 0.18
155 0.18
156 0.21
157 0.2
158 0.18
159 0.17
160 0.16
161 0.16
162 0.15
163 0.12
164 0.1
165 0.1
166 0.09
167 0.09
168 0.08
169 0.06
170 0.06
171 0.05
172 0.04
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.07
181 0.07
182 0.1
183 0.11
184 0.1
185 0.1
186 0.11
187 0.12
188 0.11
189 0.15
190 0.15
191 0.18
192 0.18
193 0.19
194 0.18
195 0.16
196 0.15
197 0.11
198 0.11
199 0.09
200 0.09
201 0.09
202 0.11
203 0.15
204 0.15
205 0.15
206 0.18
207 0.15
208 0.15
209 0.18
210 0.18
211 0.16
212 0.19
213 0.2
214 0.16
215 0.19
216 0.2
217 0.17
218 0.16
219 0.14
220 0.11
221 0.1
222 0.09
223 0.09
224 0.08
225 0.09
226 0.09
227 0.09
228 0.09
229 0.1
230 0.1
231 0.09
232 0.1
233 0.1
234 0.11
235 0.12
236 0.12
237 0.11
238 0.1
239 0.1
240 0.09
241 0.08
242 0.06
243 0.05
244 0.05
245 0.06
246 0.06
247 0.05
248 0.05
249 0.05
250 0.06
251 0.05
252 0.08
253 0.09
254 0.11
255 0.12
256 0.13
257 0.13
258 0.16
259 0.16
260 0.13
261 0.13
262 0.11
263 0.14
264 0.16
265 0.17
266 0.15
267 0.16
268 0.15
269 0.16
270 0.16
271 0.12
272 0.09
273 0.08
274 0.07
275 0.07
276 0.07
277 0.06
278 0.05
279 0.05
280 0.05
281 0.04
282 0.04
283 0.03
284 0.04
285 0.06
286 0.07
287 0.08
288 0.11
289 0.12
290 0.19
291 0.23
292 0.3
293 0.36
294 0.46
295 0.54
296 0.61
297 0.71
298 0.73
299 0.78
300 0.8
301 0.8
302 0.81
303 0.83
304 0.82
305 0.76
306 0.71
307 0.69
308 0.69
309 0.68
310 0.65
311 0.59
312 0.58
313 0.58
314 0.6
315 0.62
316 0.63
317 0.65
318 0.6
319 0.59
320 0.56
321 0.58
322 0.54
323 0.48
324 0.42
325 0.34
326 0.32
327 0.31
328 0.32
329 0.27
330 0.25
331 0.23
332 0.21
333 0.22
334 0.26
335 0.26
336 0.19
337 0.19
338 0.19
339 0.19
340 0.16
341 0.15
342 0.09
343 0.09
344 0.07
345 0.07
346 0.07
347 0.07
348 0.08
349 0.09
350 0.1
351 0.13
352 0.16
353 0.18
354 0.21
355 0.24
356 0.27
357 0.33
358 0.4
359 0.4
360 0.41
361 0.42
362 0.39
363 0.37
364 0.35
365 0.32
366 0.25
367 0.2
368 0.17
369 0.15
370 0.15
371 0.15
372 0.14
373 0.09
374 0.09
375 0.12
376 0.13
377 0.13
378 0.13
379 0.15
380 0.17
381 0.19
382 0.24
383 0.28
384 0.28
385 0.29
386 0.3
387 0.3
388 0.32
389 0.32
390 0.29
391 0.24
392 0.26
393 0.27
394 0.27
395 0.24
396 0.21
397 0.24
398 0.23
399 0.2
400 0.18
401 0.17
402 0.17
403 0.21
404 0.24
405 0.23
406 0.24
407 0.24
408 0.24
409 0.24
410 0.23
411 0.22
412 0.21
413 0.24
414 0.25
415 0.25
416 0.25
417 0.25
418 0.26
419 0.29
420 0.26
421 0.22
422 0.2
423 0.25
424 0.28
425 0.3
426 0.31
427 0.26
428 0.28
429 0.29
430 0.35
431 0.37
432 0.4
433 0.4
434 0.4
435 0.43