Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YZ35

Protein Details
Accession A0A4P9YZ35    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24EKKKWEPPIPTRVGKKKRKGADTABasic
NLS Segment(s)
PositionSequence
3-20KKWEPPIPTRVGKKKRKG
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences EKKKWEPPIPTRVGKKKRKGADTANKLPAVFPTTRCRLKLLKLERIKDYMLMEEEFVINQERLKPQDEKNQEERSRVDDLRGSPMGVGTLVEII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.81
4 0.82
5 0.81
6 0.79
7 0.79
8 0.8
9 0.8
10 0.78
11 0.75
12 0.67
13 0.6
14 0.52
15 0.43
16 0.36
17 0.27
18 0.22
19 0.23
20 0.29
21 0.32
22 0.33
23 0.35
24 0.33
25 0.38
26 0.43
27 0.44
28 0.47
29 0.5
30 0.52
31 0.5
32 0.5
33 0.44
34 0.37
35 0.3
36 0.22
37 0.17
38 0.14
39 0.12
40 0.1
41 0.1
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.1
48 0.12
49 0.14
50 0.18
51 0.22
52 0.25
53 0.35
54 0.41
55 0.45
56 0.51
57 0.59
58 0.57
59 0.57
60 0.54
61 0.48
62 0.48
63 0.42
64 0.37
65 0.31
66 0.31
67 0.34
68 0.33
69 0.3
70 0.23
71 0.23
72 0.2
73 0.16
74 0.14