Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YWC2

Protein Details
Accession A0A4P9YWC2    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
197-235EDEASGRDKNKRKKVDREPKRPSKRPKKRKLYTDTIGMVBasic
NLS Segment(s)
PositionSequence
64-75KIERREATRERK
203-226RDKNKRKKVDREPKRPSKRPKKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR006958  Mak16  
Pfam View protein in Pfam  
PF04874  Mak16  
Amino Acid Sequences MGWHGHHRIIYLYMKTAERAHTPAKLWERVKLSKNYVKALEQYLIRMRKLKLKNTPTLVGINKKIERREATRERKAEAAARLDKAIEKELLDRLKNKAYGEEPLNVNEDVWREILEEHKIEVESDVTTEDEEMEDEEEEEEEEEEEEEEFEHEFVSDISDEEVSDFEDMMSSSKYSEDMSSDDEDDEDDEDNMASDEDEASGRDKNKRKKVDREPKRPSKRPKKRKLYTDTIGMVDAYVYVAAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.31
4 0.3
5 0.28
6 0.31
7 0.31
8 0.32
9 0.33
10 0.39
11 0.43
12 0.48
13 0.46
14 0.48
15 0.51
16 0.54
17 0.59
18 0.58
19 0.6
20 0.58
21 0.61
22 0.6
23 0.56
24 0.51
25 0.47
26 0.43
27 0.39
28 0.33
29 0.33
30 0.35
31 0.36
32 0.34
33 0.36
34 0.34
35 0.4
36 0.47
37 0.51
38 0.54
39 0.58
40 0.64
41 0.64
42 0.65
43 0.58
44 0.56
45 0.52
46 0.48
47 0.44
48 0.43
49 0.42
50 0.44
51 0.44
52 0.44
53 0.45
54 0.44
55 0.5
56 0.54
57 0.59
58 0.64
59 0.64
60 0.59
61 0.56
62 0.53
63 0.48
64 0.41
65 0.39
66 0.33
67 0.32
68 0.3
69 0.28
70 0.28
71 0.24
72 0.22
73 0.15
74 0.12
75 0.13
76 0.18
77 0.21
78 0.21
79 0.22
80 0.23
81 0.27
82 0.28
83 0.27
84 0.25
85 0.22
86 0.25
87 0.25
88 0.26
89 0.22
90 0.21
91 0.23
92 0.2
93 0.19
94 0.15
95 0.14
96 0.11
97 0.1
98 0.09
99 0.07
100 0.08
101 0.1
102 0.1
103 0.1
104 0.09
105 0.1
106 0.09
107 0.09
108 0.09
109 0.08
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.04
125 0.04
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.07
158 0.06
159 0.06
160 0.07
161 0.07
162 0.08
163 0.09
164 0.09
165 0.1
166 0.13
167 0.15
168 0.15
169 0.15
170 0.14
171 0.13
172 0.12
173 0.12
174 0.09
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.06
187 0.08
188 0.12
189 0.15
190 0.24
191 0.33
192 0.42
193 0.52
194 0.63
195 0.7
196 0.77
197 0.86
198 0.88
199 0.9
200 0.92
201 0.92
202 0.93
203 0.95
204 0.94
205 0.94
206 0.94
207 0.94
208 0.94
209 0.95
210 0.95
211 0.94
212 0.95
213 0.92
214 0.91
215 0.85
216 0.83
217 0.75
218 0.65
219 0.55
220 0.44
221 0.35
222 0.25
223 0.19
224 0.1