Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YWI1

Protein Details
Accession A0A4P9YWI1    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
269-288NWGILTKDRKPKAKFPKCSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000490  Glyco_hydro_17  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00332  Glyco_hydro_17  
Amino Acid Sequences TIVPSPDLVKSFYGITYTPLNAQYPECGGSLGDVIEDIKVLSQLTTRLRLYGMDCDQASHTLEAIKQLKVDMKIVVTIWVDENPVTYKRQYDLFWKLLKDYNTDNILGVSVGNEAIFRKESNATDLGARMSDVRSQLKARGFATMPVFTTDLGDNFKADLISESDEAWANVHPFFAGINVSEGATWTWDFYERFIGKPARSAGKKGIISETGWPTKGEAKQNAIPSRDGLQRFLDDFVCQTNAKGIPYYFFEAFDAPWKVAKFTELEGNWGILTKDRKPKAKFPKCSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.18
5 0.2
6 0.21
7 0.22
8 0.22
9 0.23
10 0.22
11 0.2
12 0.21
13 0.18
14 0.16
15 0.14
16 0.13
17 0.13
18 0.11
19 0.08
20 0.06
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.12
31 0.16
32 0.21
33 0.21
34 0.22
35 0.22
36 0.24
37 0.25
38 0.28
39 0.27
40 0.25
41 0.25
42 0.25
43 0.26
44 0.26
45 0.25
46 0.18
47 0.15
48 0.13
49 0.13
50 0.19
51 0.21
52 0.2
53 0.18
54 0.19
55 0.23
56 0.23
57 0.24
58 0.18
59 0.16
60 0.17
61 0.17
62 0.18
63 0.14
64 0.13
65 0.12
66 0.12
67 0.12
68 0.1
69 0.11
70 0.11
71 0.13
72 0.14
73 0.14
74 0.15
75 0.16
76 0.2
77 0.2
78 0.25
79 0.3
80 0.33
81 0.36
82 0.34
83 0.35
84 0.37
85 0.36
86 0.32
87 0.27
88 0.27
89 0.25
90 0.25
91 0.23
92 0.18
93 0.17
94 0.14
95 0.11
96 0.06
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.06
103 0.07
104 0.06
105 0.08
106 0.11
107 0.11
108 0.14
109 0.15
110 0.14
111 0.14
112 0.15
113 0.13
114 0.1
115 0.1
116 0.07
117 0.07
118 0.09
119 0.11
120 0.12
121 0.13
122 0.14
123 0.19
124 0.2
125 0.23
126 0.21
127 0.21
128 0.2
129 0.21
130 0.23
131 0.19
132 0.17
133 0.16
134 0.15
135 0.12
136 0.13
137 0.1
138 0.09
139 0.1
140 0.09
141 0.08
142 0.08
143 0.08
144 0.07
145 0.07
146 0.07
147 0.06
148 0.08
149 0.08
150 0.08
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.07
157 0.07
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.04
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.06
171 0.07
172 0.07
173 0.05
174 0.06
175 0.08
176 0.09
177 0.09
178 0.18
179 0.18
180 0.18
181 0.24
182 0.28
183 0.25
184 0.3
185 0.33
186 0.32
187 0.33
188 0.35
189 0.36
190 0.4
191 0.41
192 0.38
193 0.37
194 0.31
195 0.3
196 0.33
197 0.33
198 0.28
199 0.27
200 0.26
201 0.24
202 0.29
203 0.33
204 0.34
205 0.32
206 0.36
207 0.4
208 0.48
209 0.52
210 0.47
211 0.43
212 0.38
213 0.39
214 0.39
215 0.35
216 0.3
217 0.28
218 0.28
219 0.28
220 0.28
221 0.24
222 0.18
223 0.18
224 0.17
225 0.17
226 0.15
227 0.14
228 0.17
229 0.18
230 0.19
231 0.21
232 0.19
233 0.18
234 0.23
235 0.28
236 0.23
237 0.22
238 0.22
239 0.2
240 0.2
241 0.25
242 0.23
243 0.19
244 0.22
245 0.22
246 0.22
247 0.22
248 0.23
249 0.18
250 0.18
251 0.26
252 0.23
253 0.26
254 0.26
255 0.26
256 0.24
257 0.23
258 0.21
259 0.18
260 0.22
261 0.26
262 0.36
263 0.42
264 0.52
265 0.58
266 0.68
267 0.74
268 0.8