Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9YTC8

Protein Details
Accession A0A4P9YTC8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
104-131TGTFQRLKKLSKKEKKVKKRNLSEFVRSHydrophilic
NLS Segment(s)
PositionSequence
110-123LKKLSKKEKKVKKR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040240  TAF1  
IPR022591  TAF1_HAT_dom  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0004402  F:histone acetyltransferase activity  
GO:0001091  F:RNA polymerase II general transcription initiation factor binding  
GO:0017025  F:TBP-class protein binding  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF12157  DUF3591  
Amino Acid Sequences MNDPHMLFEVVDEETLDNKRRRTARDHSSASMELVSDLNLSNDKYYEVSREARLQRVRQTFGQLIVQHTLPAIKLQLPYYKIRMSKKELRSFHRPPLSVAAGTTGTFQRLKKLSKKEKKVKKRNLSEFVRSAKQLSLRDTGDFVLLEYSEEHPPIVSNIGMGSMVVNYYRKEDPQDMFVPKSETGVPFVLETTDASPFMNFGNVEPGQTITALYNNLVRAPIFSQRVPSTDFLVIRHKFEQETKWYLKEIPSLFVVGQTYPVQEVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.23
4 0.25
5 0.27
6 0.35
7 0.4
8 0.45
9 0.5
10 0.56
11 0.59
12 0.65
13 0.68
14 0.64
15 0.63
16 0.59
17 0.51
18 0.42
19 0.32
20 0.22
21 0.17
22 0.14
23 0.09
24 0.08
25 0.08
26 0.1
27 0.1
28 0.1
29 0.1
30 0.11
31 0.12
32 0.13
33 0.15
34 0.18
35 0.21
36 0.23
37 0.31
38 0.33
39 0.4
40 0.45
41 0.46
42 0.51
43 0.54
44 0.55
45 0.49
46 0.52
47 0.46
48 0.42
49 0.43
50 0.35
51 0.31
52 0.29
53 0.27
54 0.2
55 0.19
56 0.17
57 0.11
58 0.11
59 0.09
60 0.1
61 0.11
62 0.13
63 0.18
64 0.21
65 0.24
66 0.27
67 0.31
68 0.34
69 0.38
70 0.42
71 0.46
72 0.52
73 0.59
74 0.64
75 0.65
76 0.66
77 0.7
78 0.69
79 0.7
80 0.67
81 0.58
82 0.51
83 0.51
84 0.46
85 0.37
86 0.31
87 0.24
88 0.18
89 0.17
90 0.17
91 0.11
92 0.1
93 0.13
94 0.13
95 0.17
96 0.21
97 0.26
98 0.32
99 0.43
100 0.52
101 0.6
102 0.7
103 0.75
104 0.81
105 0.87
106 0.9
107 0.91
108 0.9
109 0.9
110 0.89
111 0.88
112 0.83
113 0.77
114 0.71
115 0.64
116 0.56
117 0.46
118 0.37
119 0.3
120 0.29
121 0.25
122 0.23
123 0.23
124 0.22
125 0.22
126 0.22
127 0.2
128 0.16
129 0.14
130 0.1
131 0.07
132 0.06
133 0.06
134 0.06
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.04
150 0.03
151 0.04
152 0.04
153 0.06
154 0.06
155 0.1
156 0.11
157 0.11
158 0.15
159 0.19
160 0.2
161 0.24
162 0.29
163 0.28
164 0.28
165 0.29
166 0.28
167 0.24
168 0.24
169 0.21
170 0.17
171 0.17
172 0.16
173 0.16
174 0.13
175 0.13
176 0.11
177 0.1
178 0.1
179 0.08
180 0.09
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.1
187 0.08
188 0.08
189 0.14
190 0.14
191 0.14
192 0.14
193 0.15
194 0.13
195 0.13
196 0.13
197 0.07
198 0.09
199 0.09
200 0.1
201 0.11
202 0.11
203 0.12
204 0.12
205 0.12
206 0.12
207 0.14
208 0.2
209 0.21
210 0.21
211 0.27
212 0.28
213 0.3
214 0.32
215 0.31
216 0.28
217 0.29
218 0.29
219 0.26
220 0.34
221 0.33
222 0.34
223 0.35
224 0.33
225 0.31
226 0.35
227 0.39
228 0.37
229 0.44
230 0.44
231 0.44
232 0.45
233 0.44
234 0.43
235 0.44
236 0.38
237 0.32
238 0.29
239 0.29
240 0.27
241 0.26
242 0.24
243 0.17
244 0.19
245 0.17
246 0.16