Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z1K9

Protein Details
Accession A0A4P9Z1K9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-58RECGHRVMYKRRTTRSKYWRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences GSQGGFYQSTQPPQIVYLCAIDCGADNELKPREPIRCRECGHRVMYKRRTTRSKYWRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.18
3 0.16
4 0.15
5 0.13
6 0.13
7 0.12
8 0.1
9 0.09
10 0.1
11 0.09
12 0.07
13 0.07
14 0.11
15 0.12
16 0.12
17 0.14
18 0.14
19 0.2
20 0.24
21 0.33
22 0.34
23 0.41
24 0.43
25 0.5
26 0.55
27 0.54
28 0.55
29 0.55
30 0.58
31 0.6
32 0.68
33 0.69
34 0.71
35 0.74
36 0.78
37 0.78
38 0.81