Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z1D9

Protein Details
Accession A0A4P9Z1D9   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSTLAKERTKSRKGRRHAANDAWQVLHydrophilic
219-238SSAVKFKKRCLYGKRVTRADHydrophilic
NLS Segment(s)
PositionSequence
9-16TKSRKGRR
80-96RKKRRAIDTRLKSQRKG
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MSTLAKERTKSRKGRRHAANDAWQVLAAKDEPTAAAATADAVESDDEAPEAISLSAGKQQAETAARQAQLAIDEQAAQLRKKRRAIDTRLKSQRKGRDERAQTVAQSELALPTELLDSVAEQDEQQKEQQRALAEEAAKKRANHTQFDSDDDMSDDELHHNDAASSSGAPMDWARGTRRTPGDVGRQKRARNEEVTVKRSGIQVSVLKATPKLSKPIDSSAVKFKKRCLYGKRVTRADALRHTAFRKLAVPLQFARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.87
5 0.86
6 0.84
7 0.81
8 0.74
9 0.63
10 0.53
11 0.44
12 0.34
13 0.27
14 0.18
15 0.12
16 0.1
17 0.1
18 0.09
19 0.1
20 0.1
21 0.08
22 0.08
23 0.07
24 0.07
25 0.07
26 0.07
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.1
43 0.12
44 0.12
45 0.11
46 0.12
47 0.16
48 0.18
49 0.18
50 0.18
51 0.2
52 0.21
53 0.2
54 0.2
55 0.16
56 0.15
57 0.16
58 0.12
59 0.08
60 0.09
61 0.09
62 0.12
63 0.14
64 0.13
65 0.18
66 0.25
67 0.32
68 0.38
69 0.44
70 0.5
71 0.57
72 0.66
73 0.71
74 0.72
75 0.75
76 0.8
77 0.78
78 0.73
79 0.71
80 0.71
81 0.68
82 0.68
83 0.66
84 0.65
85 0.67
86 0.67
87 0.64
88 0.57
89 0.48
90 0.41
91 0.34
92 0.24
93 0.18
94 0.13
95 0.08
96 0.07
97 0.07
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.09
110 0.09
111 0.1
112 0.13
113 0.17
114 0.18
115 0.18
116 0.21
117 0.18
118 0.18
119 0.19
120 0.2
121 0.16
122 0.2
123 0.21
124 0.24
125 0.26
126 0.24
127 0.25
128 0.29
129 0.31
130 0.3
131 0.33
132 0.35
133 0.34
134 0.38
135 0.38
136 0.31
137 0.28
138 0.25
139 0.21
140 0.13
141 0.13
142 0.09
143 0.07
144 0.07
145 0.08
146 0.07
147 0.07
148 0.06
149 0.06
150 0.07
151 0.06
152 0.06
153 0.05
154 0.06
155 0.05
156 0.06
157 0.06
158 0.07
159 0.07
160 0.09
161 0.12
162 0.16
163 0.18
164 0.24
165 0.27
166 0.27
167 0.29
168 0.33
169 0.41
170 0.45
171 0.49
172 0.53
173 0.56
174 0.56
175 0.61
176 0.64
177 0.58
178 0.54
179 0.53
180 0.54
181 0.56
182 0.57
183 0.51
184 0.44
185 0.4
186 0.38
187 0.34
188 0.24
189 0.21
190 0.21
191 0.21
192 0.24
193 0.23
194 0.22
195 0.22
196 0.25
197 0.26
198 0.26
199 0.31
200 0.31
201 0.35
202 0.38
203 0.42
204 0.47
205 0.43
206 0.44
207 0.48
208 0.53
209 0.54
210 0.52
211 0.54
212 0.55
213 0.6
214 0.66
215 0.64
216 0.66
217 0.7
218 0.78
219 0.81
220 0.77
221 0.72
222 0.71
223 0.68
224 0.65
225 0.62
226 0.59
227 0.54
228 0.54
229 0.53
230 0.51
231 0.47
232 0.42
233 0.37
234 0.35
235 0.36
236 0.36
237 0.39