Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VJH3

Protein Details
Accession K1VJH3    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-65LDDYNPHQRRRSPREPSEPMPEHHydrophilic
406-431ADLDRMRGGRSRRPQRNKDDLDRELDBasic
NLS Segment(s)
PositionSequence
329-361RKGARDSAWYAKHGRGAGKEVAPRRGYRDEPRS
368-394TRGEGRDLSRRIRPYDRDRERADRGDR
Subcellular Location(s) nucl 9.5, cyto_nucl 9.5, cyto 8.5, mito 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MDEFGGLPYTDEAAAAAQEAQAAQAAEASNSMDVDHPMLDRALDDYNPHQRRRSPREPSEPMPEHVQSLLGRMGKGKVYLMDESPGIIHHDGELRLSRDPVLRKLARELDKQDPTQWLTMVSESASSPIRPNALFVSSTLIEHMSTAKIFTWASELGAKPMGIEWLNDTTLILLFQTPAAALLGLSLLSKAGFDPTEGDDPLLERSAHGFPISLLPRAEARREDRERDRGSREDREAERRRELDRQLDEEMKAYRRETGQAEPAAEEPKMAADKLEAEEEPVRRRGRGAFTADTGAFDDAPAHPQFAEGVDPYARVTVRYALEGDNAKRKGARDSAWYAKHGRGAGKEVAPRRGYRDEPRSLADRVGTRGEGRDLSRRIRPYDRDRERADRGDRGDRRSRVADLDADLDRMRGGRSRRPQRNKDDLDRELDEMFASRKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.06
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.07
11 0.09
12 0.1
13 0.09
14 0.1
15 0.11
16 0.09
17 0.09
18 0.1
19 0.09
20 0.09
21 0.1
22 0.11
23 0.1
24 0.11
25 0.11
26 0.11
27 0.1
28 0.11
29 0.12
30 0.12
31 0.14
32 0.19
33 0.3
34 0.36
35 0.39
36 0.43
37 0.48
38 0.58
39 0.66
40 0.7
41 0.7
42 0.73
43 0.81
44 0.83
45 0.81
46 0.81
47 0.75
48 0.67
49 0.62
50 0.53
51 0.44
52 0.36
53 0.34
54 0.23
55 0.22
56 0.24
57 0.19
58 0.19
59 0.19
60 0.21
61 0.2
62 0.21
63 0.19
64 0.17
65 0.19
66 0.21
67 0.21
68 0.2
69 0.18
70 0.18
71 0.16
72 0.14
73 0.13
74 0.12
75 0.1
76 0.1
77 0.14
78 0.14
79 0.16
80 0.19
81 0.18
82 0.19
83 0.19
84 0.21
85 0.22
86 0.26
87 0.28
88 0.34
89 0.35
90 0.35
91 0.41
92 0.48
93 0.48
94 0.5
95 0.51
96 0.51
97 0.54
98 0.53
99 0.5
100 0.46
101 0.42
102 0.38
103 0.32
104 0.24
105 0.2
106 0.19
107 0.16
108 0.12
109 0.1
110 0.09
111 0.1
112 0.1
113 0.1
114 0.11
115 0.12
116 0.14
117 0.13
118 0.15
119 0.15
120 0.16
121 0.15
122 0.14
123 0.18
124 0.15
125 0.16
126 0.15
127 0.13
128 0.11
129 0.11
130 0.12
131 0.08
132 0.07
133 0.08
134 0.08
135 0.09
136 0.09
137 0.08
138 0.1
139 0.1
140 0.11
141 0.14
142 0.13
143 0.13
144 0.15
145 0.14
146 0.11
147 0.11
148 0.12
149 0.09
150 0.09
151 0.1
152 0.11
153 0.11
154 0.11
155 0.1
156 0.09
157 0.08
158 0.08
159 0.06
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.05
181 0.07
182 0.09
183 0.11
184 0.11
185 0.11
186 0.1
187 0.11
188 0.12
189 0.11
190 0.08
191 0.06
192 0.09
193 0.1
194 0.1
195 0.1
196 0.09
197 0.08
198 0.14
199 0.15
200 0.14
201 0.13
202 0.13
203 0.17
204 0.18
205 0.2
206 0.17
207 0.2
208 0.28
209 0.31
210 0.37
211 0.38
212 0.46
213 0.49
214 0.5
215 0.5
216 0.47
217 0.48
218 0.49
219 0.46
220 0.44
221 0.43
222 0.48
223 0.51
224 0.5
225 0.5
226 0.46
227 0.47
228 0.46
229 0.46
230 0.43
231 0.39
232 0.37
233 0.35
234 0.35
235 0.32
236 0.28
237 0.28
238 0.22
239 0.21
240 0.18
241 0.17
242 0.16
243 0.19
244 0.2
245 0.21
246 0.24
247 0.24
248 0.24
249 0.22
250 0.23
251 0.21
252 0.18
253 0.14
254 0.09
255 0.09
256 0.09
257 0.08
258 0.07
259 0.06
260 0.08
261 0.09
262 0.11
263 0.09
264 0.11
265 0.15
266 0.17
267 0.2
268 0.24
269 0.24
270 0.23
271 0.25
272 0.27
273 0.29
274 0.33
275 0.35
276 0.31
277 0.32
278 0.35
279 0.33
280 0.29
281 0.24
282 0.18
283 0.12
284 0.1
285 0.1
286 0.07
287 0.11
288 0.11
289 0.1
290 0.1
291 0.1
292 0.1
293 0.1
294 0.11
295 0.07
296 0.09
297 0.09
298 0.09
299 0.1
300 0.11
301 0.11
302 0.1
303 0.11
304 0.14
305 0.14
306 0.15
307 0.17
308 0.15
309 0.19
310 0.23
311 0.24
312 0.28
313 0.28
314 0.28
315 0.29
316 0.29
317 0.32
318 0.33
319 0.33
320 0.31
321 0.37
322 0.45
323 0.46
324 0.48
325 0.45
326 0.41
327 0.43
328 0.39
329 0.35
330 0.29
331 0.31
332 0.33
333 0.35
334 0.39
335 0.39
336 0.44
337 0.43
338 0.42
339 0.43
340 0.45
341 0.46
342 0.49
343 0.54
344 0.53
345 0.53
346 0.55
347 0.53
348 0.48
349 0.44
350 0.39
351 0.33
352 0.29
353 0.29
354 0.27
355 0.24
356 0.25
357 0.26
358 0.25
359 0.25
360 0.31
361 0.32
362 0.36
363 0.42
364 0.45
365 0.48
366 0.53
367 0.59
368 0.61
369 0.68
370 0.72
371 0.73
372 0.75
373 0.77
374 0.75
375 0.75
376 0.7
377 0.66
378 0.63
379 0.66
380 0.64
381 0.64
382 0.66
383 0.61
384 0.61
385 0.58
386 0.54
387 0.48
388 0.45
389 0.41
390 0.33
391 0.35
392 0.29
393 0.28
394 0.25
395 0.21
396 0.19
397 0.16
398 0.15
399 0.17
400 0.21
401 0.29
402 0.4
403 0.51
404 0.62
405 0.72
406 0.81
407 0.85
408 0.91
409 0.9
410 0.9
411 0.89
412 0.82
413 0.78
414 0.71
415 0.63
416 0.52
417 0.43
418 0.33
419 0.25
420 0.22