Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YZ47

Protein Details
Accession A0A4P9YZ47   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
177-217LSADRRMPRVQRHGKGKRANSSGKKQKPSRWHDGRRASGEMHydrophilic
NLS Segment(s)
PositionSequence
182-212RMPRVQRHGKGKRANSSGKKQKPSRWHDGRR
Subcellular Location(s) cyto 13.5, cyto_mito 9.5, nucl 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR007222  Sig_recog_particle_rcpt_asu_N  
Gene Ontology GO:0005785  C:signal recognition particle receptor complex  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0005047  F:signal recognition particle binding  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF04086  SRP-alpha_N  
CDD cd14826  SR_alpha_SRX  
Amino Acid Sequences MLDHVTIFTRGGIVLWSSSFSSLQGDPVNDLVREVLVEERTGQRAFEHGAYTVHWALANELNLVFVAVYQKILQLAYVEDLLASVRRAFTEMFADILADCMTAVVPRERFAAFDAKYATIARKLEERAYSSRATRKPRRFEETKKYQNTLEGSRGKDKRADRGASSQVEESNEDEALSADRRMPRVQRHGKGKRANSSGKKQKPSRWHDGRRASGEMAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.12
6 0.12
7 0.11
8 0.14
9 0.13
10 0.16
11 0.17
12 0.17
13 0.17
14 0.19
15 0.21
16 0.17
17 0.17
18 0.14
19 0.11
20 0.11
21 0.1
22 0.11
23 0.09
24 0.1
25 0.12
26 0.14
27 0.18
28 0.18
29 0.17
30 0.14
31 0.16
32 0.18
33 0.18
34 0.16
35 0.14
36 0.14
37 0.15
38 0.19
39 0.17
40 0.15
41 0.13
42 0.12
43 0.13
44 0.16
45 0.15
46 0.12
47 0.11
48 0.11
49 0.1
50 0.1
51 0.08
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.07
64 0.07
65 0.06
66 0.05
67 0.05
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.07
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.07
83 0.08
84 0.07
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.05
91 0.06
92 0.07
93 0.08
94 0.1
95 0.1
96 0.1
97 0.12
98 0.17
99 0.15
100 0.17
101 0.18
102 0.16
103 0.17
104 0.17
105 0.16
106 0.13
107 0.13
108 0.12
109 0.14
110 0.15
111 0.18
112 0.19
113 0.22
114 0.22
115 0.25
116 0.26
117 0.26
118 0.33
119 0.36
120 0.43
121 0.5
122 0.56
123 0.62
124 0.67
125 0.72
126 0.72
127 0.75
128 0.76
129 0.77
130 0.78
131 0.74
132 0.69
133 0.61
134 0.58
135 0.53
136 0.46
137 0.43
138 0.38
139 0.37
140 0.43
141 0.45
142 0.41
143 0.44
144 0.43
145 0.44
146 0.47
147 0.47
148 0.42
149 0.46
150 0.51
151 0.47
152 0.47
153 0.39
154 0.32
155 0.3
156 0.28
157 0.22
158 0.17
159 0.15
160 0.13
161 0.11
162 0.1
163 0.1
164 0.11
165 0.1
166 0.13
167 0.16
168 0.18
169 0.23
170 0.29
171 0.36
172 0.46
173 0.55
174 0.6
175 0.68
176 0.75
177 0.8
178 0.83
179 0.83
180 0.81
181 0.79
182 0.81
183 0.79
184 0.8
185 0.82
186 0.82
187 0.84
188 0.82
189 0.83
190 0.83
191 0.83
192 0.83
193 0.83
194 0.84
195 0.84
196 0.87
197 0.87
198 0.82
199 0.77