Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9YXD7

Protein Details
Accession A0A4P9YXD7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-90AVNHYREKKKKTAQKEQEQEAAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPSNPVYSVVGGVAGATIGYITGSEKGAALGAAAGATIGLTRAMTVALPIVSLPSVVAASVATNVLIYAVNHYREKKKKTAQKEQEQEAAAATTIEEEQPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.02
6 0.02
7 0.03
8 0.04
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.07
15 0.06
16 0.05
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.03
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.08
56 0.11
57 0.14
58 0.17
59 0.21
60 0.3
61 0.38
62 0.45
63 0.5
64 0.57
65 0.63
66 0.71
67 0.79
68 0.8
69 0.83
70 0.85
71 0.81
72 0.78
73 0.7
74 0.6
75 0.49
76 0.39
77 0.28
78 0.19
79 0.14
80 0.09
81 0.08