Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z4I6

Protein Details
Accession A0A4P9Z4I6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-81LPEPKQHKPLRVKPPKGTKYBasic
NLS Segment(s)
PositionSequence
66-79KQHKPLRVKPPKGT
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040922  MRPL25_dom  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MATARIFSKRLLQLSRLQYKAEDFQTSFVNGHWRQPRIGPRRQADLRKACLLEGRDPASHGLPEPKQHKPLRVKPPKGTKYQRNYEERKAKVEKSLSDMPTKITEWKEVRGMRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.52
4 0.47
5 0.42
6 0.42
7 0.44
8 0.39
9 0.33
10 0.25
11 0.25
12 0.26
13 0.27
14 0.23
15 0.18
16 0.24
17 0.2
18 0.28
19 0.32
20 0.32
21 0.31
22 0.37
23 0.46
24 0.45
25 0.53
26 0.53
27 0.5
28 0.58
29 0.63
30 0.64
31 0.63
32 0.62
33 0.58
34 0.54
35 0.51
36 0.42
37 0.39
38 0.35
39 0.29
40 0.25
41 0.23
42 0.19
43 0.2
44 0.2
45 0.17
46 0.15
47 0.12
48 0.14
49 0.12
50 0.19
51 0.23
52 0.25
53 0.33
54 0.35
55 0.43
56 0.48
57 0.57
58 0.62
59 0.68
60 0.71
61 0.72
62 0.81
63 0.79
64 0.79
65 0.79
66 0.77
67 0.76
68 0.79
69 0.79
70 0.77
71 0.78
72 0.78
73 0.78
74 0.71
75 0.7
76 0.66
77 0.59
78 0.58
79 0.57
80 0.49
81 0.47
82 0.52
83 0.47
84 0.46
85 0.44
86 0.39
87 0.37
88 0.36
89 0.35
90 0.29
91 0.35
92 0.33
93 0.37
94 0.43